PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G28100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 572aa    MW: 63962.1 Da    PI: 9.1014
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G28100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS353.24e-1081935682373
          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                    +lLl+cA+av+++d + a++lL ++++++sp gd+ qRla++f+++L+arla+++s++y++l +++ts   +++ l+a++l+ e++ + k++++  
  OB11G28100.1 193 HNLLLQCAQAVTTDDRRSAHELLRQIKQHSSPWGDAAQRLAHCFAQGLEARLAGTGSQVYQSLMSRRTS---VVDFLKAYRLYMEACCCKKVAFVFS 286
                   689************************************************************999999...************************* PP

          GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                   N++I++av+g +r+Hi+D+++s+G+QWp Ll++La+R++gpp++RiTg++ p++g   ++ + etg+rLak+A+elgvpf+f+ ++a++ e+++le+
  OB11G28100.1 287 NKTIYDAVAGRSRLHIVDYGLSYGFQWPGLLRELAARTGGPPEVRITGIDLPQPGfhATQHIDETGRRLAKYADELGVPFKFQGIAATKKESVRLED 383
                   ******************************************************99999**************************999********* PP

          GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                   L+++ +E+l+V +  q  +++desvs ++     +rdevL+ +++++P+v+++   +  ++++ Fl+rf eal yy+a fd lea+++r s+er+ v
  OB11G28100.1 384 LETEADEVLVVISLCQFRNVMDESVSPAEerrmsPRDEVLSNIRRMRPDVFIHGIMNGGYGATYFLTRFREALFYYAAQFDLLEATVARPSHERMLV 480
                   ***********************9987766677799************************************************************* PP

          GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                   Er ++gr++vnv+acegaer+er et+++W++r ++aG++++pl+ k+++ +   +r  + + + v++++ +l+  Wk+r L+++S W
  OB11G28100.1 481 ERDIFGRAAVNVIACEGAERVERPETYKQWQARNQRAGLTQLPLNPKVVTLVLDKIRDRYHKDFVVDQDHRWLLHRWKGRVLYALSTW 568
                   ****************************************************99999999888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.853166549IPR005202Transcription factor GRAS
PfamPF035141.4E-105193568IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MSSSPSPRSL LPLLLPPPPA RRPPPPMPRP AGPSTFPTAQ VNSVDQAATS YGLLGAGSDM  60
LNMAFLKGME EANRFLPTTN GSQRLLMLGQ GELVTHGGRK DRDDSEVGAG RAAKLMAPEP  120
ELEEEGASEM FDEMMLQQHE ICMKGVKQLS VSTGSETGKK AKPRTKSSSK EGGGEKRPRG  180
RRSTIHTETV DLHNLLLQCA QAVTTDDRRS AHELLRQIKQ HSSPWGDAAQ RLAHCFAQGL  240
EARLAGTGSQ VYQSLMSRRT SVVDFLKAYR LYMEACCCKK VAFVFSNKTI YDAVAGRSRL  300
HIVDYGLSYG FQWPGLLREL AARTGGPPEV RITGIDLPQP GFHATQHIDE TGRRLAKYAD  360
ELGVPFKFQG IAATKKESVR LEDLETEADE VLVVISLCQF RNVMDESVSP AEERRMSPRD  420
EVLSNIRRMR PDVFIHGIMN GGYGATYFLT RFREALFYYA AQFDLLEATV ARPSHERMLV  480
ERDIFGRAAV NVIACEGAER VERPETYKQW QARNQRAGLT QLPLNPKVVT LVLDKIRDRY  540
HKDFVVDQDH RWLLHRWKGR VLYALSTWVA LT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-371965688374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAK0635190.0AK063519.1 Oryza sativa Japonica Group cDNA clone:001-116-H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697752.10.0PREDICTED: scarecrow-like protein 9
TrEMBLJ3NAH40.0J3NAH4_ORYBR; Uncharacterized protein
STRINGOB11G28100.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-145GRAS family protein