PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G28090.1
Common NameLOC102706517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 681aa    MW: 75881.9 Da    PI: 5.3587
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G28090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.52.9e-1043006712373
          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                    +lL++cA+av+++d + a++lL++++e++s +gd++qRla++f+e+L+arla+++s++yk+l +++ts   +++ l+a+klf  ++ i k   +  
  OB11G28090.1 300 HTLLIHCAQAVATSDRRSATELLKQIKEHSSVRGDATQRLASCFAEGLEARLAGTGSQVYKSLVAKRTS---TVDFLKAYKLFTAACSIKKANVIFS 393
                   679*************************************************************99999...8************************ PP

          GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                   N++I +a+ g +++Hi+D+ + +GlQWp L++++ + ++gpp++R+Tg++ p++g   +e++eetg+rL++ A+++gvpf+f+  +a ++e+++ e+
  OB11G28090.1 394 NKTISDAMVGRRKLHIVDYCLHYGLQWPGLFRSMGEWEGGPPEVRMTGIDLPQPGfrPAEQIEETGRRLSNCARQFGVPFKFRG-IAAKWETVRRED 489
                   ******************************************************9*****************************.799********* PP

          GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                   L v+p+E+l+Vn+ + l +l desv +e+  +rd vL+ +++++P+vv+ +  +  ++++ Fl+rf eal +ysa fd+l+a++pr+++er  +Er 
  OB11G28090.1 490 LGVDPEEVLVVNCLHGLNNLQDESVVVEKasPRDVVLRNIRDMRPDVVIQCVVNGAYGAPFFLTRFREALFFYSAQFDMLDATIPRDNDERLLIERD 586
                   ************************99998889***************************************************************** PP

          GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                   +lgr++ nv+acega+r+ r et+++W+ r ++aG++++pl+ ++++ ++  +++ + + + v+ ++++l+ gWk+r L+++S W
  OB11G28090.1 587 ILGRSALNVIACEGADRVDRPETYKQWQVRNHRAGLTQLPLKPQVVQLVRDKVKTLYHKDFVVDVDNHWLLHGWKGRILYAMSTW 671
                   *********************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.695273652IPR005202Transcription factor GRAS
PfamPF035149.9E-102300671IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MSTAPPPPQL EDLEAFSPSL FLDLPPTPHD DDDPNNDDLL LPFISRMLME EDIDDKFFYQ  60
YPDHPALLDA QRPYAQILET SSSSSSGDAT TSASGSATNN SSGDSGANAA AWPYDPIELS  120
QLLQSPPHPD TLALPDHHHD AIATTKSTPE EDTDLKQLFA GVHDMEMLKM AFLKGREEAS  180
KFLPTNNPLL AAGFEVKEEP FPLVDGTTFN SGSGRGRKNR HGVEDDLEAE TGRSSKLMLP  240
EQEDTAAARE MVDEIMLSGY EVFIKGMNEL RIAMDSEAEK KTRNVGRRAA RAKEAVVDLH  300
TLLIHCAQAV ATSDRRSATE LLKQIKEHSS VRGDATQRLA SCFAEGLEAR LAGTGSQVYK  360
SLVAKRTSTV DFLKAYKLFT AACSIKKANV IFSNKTISDA MVGRRKLHIV DYCLHYGLQW  420
PGLFRSMGEW EGGPPEVRMT GIDLPQPGFR PAEQIEETGR RLSNCARQFG VPFKFRGIAA  480
KWETVRREDL GVDPEEVLVV NCLHGLNNLQ DESVVVEKAS PRDVVLRNIR DMRPDVVIQC  540
VVNGAYGAPF FLTRFREALF FYSAQFDMLD ATIPRDNDER LLIERDILGR SALNVIACEG  600
ADRVDRPETY KQWQVRNHRA GLTQLPLKPQ VVQLVRDKVK TLYHKDFVVD VDNHWLLHGW  660
KGRILYAMST WVGCSASLIS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-373036718374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663689.10.0PREDICTED: scarecrow-like protein 34
TrEMBLJ3NAH30.0J3NAH3_ORYBR; Uncharacterized protein
STRINGOB11G28090.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-153GRAS family protein