PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G27340.1
Common NameLOC102721972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 1162aa    MW: 130882 Da    PI: 8.7024
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G27340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY82.83.4e-2610171075159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY    1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59  
                    +dDg++WrKYGqK+++g+ +pr+YYrC+s+gC++ k+v+ ++++p +v+++Y+geH+++
  OB11G27340.1 1017 VDDGFSWRKYGQKPIEGAMHPRNYYRCASQGCRAAKHVQATDDNPLIVDVMYHGEHTCT 1075
                    59*******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147981.43E-112133No hitNo description
SuperFamilySSF525404.84E-55196457IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009312.5E-55202483IPR002182NB-ARC
Gene3DG3DSA:3.40.50.3002.3E-17204370IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR003643.3E-14222237No hitNo description
PRINTSPR003643.3E-14294308No hitNo description
PRINTSPR003643.3E-14391405No hitNo description
SuperFamilySSF520588.5E-21551897IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.101.1E-12553848IPR032675Leucine-rich repeat domain, L domain-like
PRINTSPR003643.3E-14693709No hitNo description
Gene3DG3DSA:2.20.25.801.1E-2610041075IPR003657WRKY domain
PROSITE profilePS5081121.98710121072IPR003657WRKY domain
SuperFamilySSF1182903.4E-2410151075IPR003657WRKY domain
SMARTSM007742.0E-3410171076IPR003657WRKY domain
PfamPF031068.5E-2410181074IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043531Molecular FunctionADP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1162 aa     Download sequence    Send to blast
MEGAMLSLPG RLEQLLRLHG SMLPKGADDE IPLIKRDLEE IISILHRHSE PKLEDDAMVV  60
RCWMKEAREL SYDMEDCIDQ YEHAAGSRTD LSGPNIRRRK LSRRQRGSKI PQKLKQRLWM  120
ANKIREFSLR AQEALRRHAM NNHNNLGSTS TSRGDGDVCS TTQTQFMVNV DAVLNDLNKL  180
KNLLAAIPAA ITSNIRRVGI DASMNKIESW LAVCDGEEKL KVVSIVGVGG IGKTTLANEL  240
YRKLGRQFEC RAFVRLSQKP DMRTILTNIL SQIRPQHQPD NWKVHTLISN IRKQLQDQRY  300
LIIVDDLWTT STWDIIKSAL PDGYSCSRIL TTTEIEDLAL QSCSYDSKYI FQMKPLGQDD  360
SRSLFLSTVF GSHSNCPPEL SEVSYDIASK CGGLPLAIVT TASLLASQLE NQERWDYINK  420
TFGYSLMANS NLEGMKQLLN LCYNNLPQHL KSCMLYLGMY QEDTIIWKDD LVNQWMAEGL  480
ISAVEEHGKE EISRSCFDEL VVRKIIQPVH INHNGEILSG VVRRMVLNFI AYKSIEDNFI  540
IAIDHPQAIT RLADKVRRLS IHFGNVEDAT LPTNMRLSQV RTLALWGILK CTSFITEFRL  600
LKVLILHFWG DEDSVSNYDL TKISELVRLR YLKVTSNVTL KLPTQMQSLR YLETLKIDGK  660
ISAVPSDIIY LPGLLHLSLP AKTNLPNGII HMTSLRKIAY FDLSCNSEEN VWSLGELTNL  720
WDIQLSYSDI HSDNLKNNME CLGSILGKLC NLKSITLSPA GSSYDNTLQI NSTTSTRISV  780
DGWSSVSSPP ALLQRFELSP CVCIFSNLPN WIGQLGNLCI LKIGIREVTN NDVDVLKVLP  840
ELTVLSLYVH TKPTEEIVIG NAGFSILKYF KFRCSIAWMK FKEGAMRNLQ KLKLGFDVHR  900
AYQHDTIPVG IGHLSGLKEI SAKIRVACTA GDLCRRFAES ALTNAIRMHP RQPSVKIRCV  960
DWTFDGKDGN NAGTQEEENR TLQKHHIVKE GSNETSAVDR RKKQRREGTK VRMSSMVDDG  1020
FSWRKYGQKP IEGAMHPRNY YRCASQGCRA AKHVQATDDN PLIVDVMYHG EHTCTPSGSG  1080
KSKITLVRRT PVSTGGRSSV GIAEAPAPLY VRSPLERLEE DEGNQLLQPL NSKSAPEKHR  1140
AAALHQARAE LNFGGSRGGR RQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j5t_C2e-42189742152735Disease resistance RPP13-like protein 4
6j5t_F2e-42189742152735Disease resistance RPP13-like protein 4
6j5t_G2e-42189742152735Disease resistance RPP13-like protein 4
6j5t_L2e-42189742152735Disease resistance RPP13-like protein 4
6j5t_O2e-42189742152735Disease resistance RPP13-like protein 4
6j5u_A2e-42189742152735Disease resistance RPP13-like protein 4
6j5v_A2e-42189742152735Disease resistance RPP13-like protein 4
6j5w_A2e-42189742152735Disease resistance RPP13-like protein 4
6j6i_C2e-42189742152735Disease resistance RPP13-like protein 4
6j6i_F2e-42189742152735Disease resistance RPP13-like protein 4
6j6i_G2e-42189742152735Disease resistance RPP13-like protein 4
6j6i_L2e-42189742152735Disease resistance RPP13-like protein 4
6j6i_O2e-42189742152735Disease resistance RPP13-like protein 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19991006RRKKQRRE
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB11G27340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015698062.10.0PREDICTED: putative disease resistance RPP13-like protein 2 isoform X2
TrEMBLJ3NA980.0J3NA98_ORYBR; Uncharacterized protein
STRINGOB11G27340.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27511933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24110.13e-18WRKY DNA-binding protein 30