PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G22500.1
Common NameLOC102708657
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YC
Protein Properties Length: 257aa    MW: 28121.3 Da    PI: 5.1045
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G22500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC59.85.9e-197861998
         NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                  +++P arikki++adedv +i+  +Pvl+s+a elf+ +l  r++  + ++  +tl+   ++++v r   fdfl+++v +
  OB11G22500.1  7 TRFPAARIKKIMQADEDVGKIALAVPVLVSRALELFLQDLIDRTYEITLQSGAKTLNSFHLKQCVRRYSSFDFLTEVVNK 86
                  579************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.0E-26372IPR009072Histone-fold
SuperFamilySSF471131.82E-20499IPR009072Histone-fold
PfamPF008086.0E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MRKKLGTRFP AARIKKIMQA DEDVGKIALA VPVLVSRALE LFLQDLIDRT YEITLQSGAK  60
TLNSFHLKQC VRRYSSFDFL TEVVNKVPDL GGADSCGDDR ALPRRRKALP NGSDPENEES  120
RSSKMAVRSA NISPRGRGRG RGRGRGRPPT KRKEVGYVQF EDESSMFAEQ GEPLPGEETV  180
PETIHGNDSI PQSAQPPAEA PSAAAIPAAD SKVEETKNDH QPDWPMPDAI GNIGVGPSGF  240
GHLTVQVDED EDYDNED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-23271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102106PRRRK
2136145RGRGRGRGRG
3136146RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4649040.0AF464904.1 Oryza sativa repressor protein (DrAp1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662993.10.0PREDICTED: dr1-associated corepressor-like
TrEMBLJ3N8W40.0J3N8W4_ORYBR; Uncharacterized protein
STRINGOB11G22500.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21723679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.11e-53nuclear factor Y, subunit C11