PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G22170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 657aa    MW: 72172.7 Da    PI: 7.7778
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G22170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS214.84.7e-662715063236
          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                     L++cA+av++gd + a ++L++++e++s +gd++qRla++f+e+L+arla+++s++y++l +++ts   +++ l a+klf  ++ i k+s++  N
  OB11G22170.1 271 AMLIHCAQAVATGDRRGAAETLKQIKEHSSVRGDATQRLASFFAEGLEARLAGTGSQVYQSLMARRTS---TVDFLRAYKLFTAACCIKKVSFVFSN 364
                   689***********************************************************999999...9************************* PP

          GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                   ++I+ a++g +++Hi+D+++ +G+QWp L++ La+R++gpp++RiTg++ p++g   ++e+eetg+rL++ A+e+gvpf+f++ +a r+e+++ ++L
  OB11G22170.1 365 RTIYGAAAGRRKLHIVDYGVHYGFQWPGLFKLLAAREGGPPEVRITGIDLPQPGfrPAREIEETGRRLSSCAREFGVPFRFHA-IAARWETVRRDDL 460
                   *****************************************************9*****************************.7************ PP

          GRAS 195 rvkpgEalaVnlvlqlhrlldesvsles....erdevLklvkslsP 236
                   +v+p+E+l+Vn+ ++l +l+des +  +    +rd+vL  ++ + P
  OB11G22170.1 461 AVDPEEVLVVNCLHHLNTLHDESPDGGEdtpsPRDAVLGNIRAMGP 506
                   ********************9986543333349*********9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.12243657IPR005202Transcription factor GRAS
PfamPF035141.6E-63271506IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MEEDIDDRFF YQYPDHPALL DAQQPYAQIL DDVSSSAVAV TSNTNTSSSS DDHSGAATNS  60
TSDDSASATC PYNPVDLYQL LRSPAHPPGT LAGLPEPDHH HHTLLVADVE GEVGADPKLL  120
FAGADRDSVE MFNLAFLKGR EEAKKFLPTN DTLFAGFHGS ARPETETEPV VDETALRTFG  180
GRDGGGRKKN RHGEDDLEAE TGRSSKLMLP GREDTAAARE MFDEIMLDEY EVFIKGMTEL  240
RIAMDSEAEK NTRNSGRREA RAKAPVVDLH AMLIHCAQAV ATGDRRGAAE TLKQIKEHSS  300
VRGDATQRLA SFFAEGLEAR LAGTGSQVYQ SLMARRTSTV DFLRAYKLFT AACCIKKVSF  360
VFSNRTIYGA AAGRRKLHIV DYGVHYGFQW PGLFKLLAAR EGGPPEVRIT GIDLPQPGFR  420
PAREIEETGR RLSSCAREFG VPFRFHAIAA RWETVRRDDL AVDPEEVLVV NCLHHLNTLH  480
DESPDGGEDT PSPRDAVLGN IRAMGPADGP RGVRPVRGER HLRRALLPDA VQGGALLLRG  540
AVRRAGRHRP ARQRRAAADR AGHPGAVRAQ RRRLRGRRPG GPAGDVQAGA GGAPPPXXXX  600
XXXXXXLPLD PGLVRLVRDM VGRLYHRDFV VDVDHRWLLQ GWKGRILYAM STWVARS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-252734838218GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179185GGRDGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663689.10.0PREDICTED: scarecrow-like protein 34
TrEMBLJ3N8T10.0J3N8T1_ORYBR; Uncharacterized protein
STRINGOB11G22170.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.13e-74GRAS family protein