PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G21910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 867aa    MW: 95278 Da    PI: 6.6931
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G21910.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.71.1e-23162263199
                   EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                   f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   + +++e
  OB11G21910.1 162 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--RGENGE 255
                   99*****************************7333.34459************************************************..449999 PP

                   .EEEEE-S CS
            B3  92 lvvkvfrk 99 
                   l+v+v+r+
  OB11G21910.1 256 LRVGVRRA 263
                   *****996 PP

2Auxin_resp114.78.2e-38288370183
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                   a+ha++t++ F+v+Y+Pr+s++eFvv++++++++lk+++s+GmRfkm+fe+e+++e+r++Gt+vg+ d+dp  Wp+SkWrsLk
  OB11G21910.1 288 AWHAVNTGTRFTVYYKPRTSPAEFVVPYDRYMESLKRNYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKWRSLK 370
                   79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-42155277IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.63E-41157291IPR015300DNA-binding pseudobarrel domain
CDDcd100177.50E-22160262No hitNo description
SMARTSM010199.9E-24162264IPR003340B3 DNA binding domain
PfamPF023621.4E-21162263IPR003340B3 DNA binding domain
PROSITE profilePS5086311.899162264IPR003340B3 DNA binding domain
PfamPF065074.7E-35288370IPR010525Auxin response factor
PfamPF023094.9E-10737823IPR033389AUX/IAA domain
PROSITE profilePS5174521.936739823IPR000270PB1 domain
SuperFamilySSF542772.6E-11742815No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 867 aa     Download sequence    Send to blast
MAAAEVEAAA GLGGGEGDAA AAAAAAARGE LWWGGGGGGG GGGGGGGGED ALFTELWSAC  60
AGPLVTVPRV GEKVFYFPQG HIEQVEASTN QVGEQRMQLY NLPWKILCEV MNVELKAEPD  120
TDEVYAQLTL LPESKQQEEN GSSEEEPTAP PATHVRPRVH SFCKTLTASD TSTHGGFSVL  180
RRHADECLPP LDMSRQPPTQ ELVAKDLHGV EWRFRHIFRG QPRRHLLQSG WSVFVSAKRL  240
VAGDAFIFLR GENGELRVGV RRAMRQQTNV PSSVISSHSM HLGVLATAWH AVNTGTRFTV  300
YYKPRTSPAE FVVPYDRYME SLKRNYSIGM RFKMRFEGEE APEQRFTGTI VGMGDSDPAG  360
WPESKWRSLK VRWDEASSIP RPERVSPWQI EPAVSPPPIN PLPVPRTKRL RPNVTASTTD  420
SSATVKEAAP KVAVEPEPNG MHRAFQTQEN ATPKAGFGNN SELDTAQKSI LRPSGFDREK  480
NNIPMQWKAG SDGRMQMNRP ESYSEMLSGF QPPKDVQTPQ GFCSLSEQIK AGHSNFWHTV  540
NAQYQDQQGN HNIFPGSWSF MPPNTGLGLN KPSYSMVQEV GGLSQRAANT KFGSGVYAPL  600
PGRGIEQYSG GWFGHMMPSS HMDDTQPRLI KPKPLVVAHG DVQKAKGASC KLFGIHLDSP  660
AKSEPLKSPS SVVYDGMPQT PGATEWHRPD VTEVEKYSDP SKPMKPLDAP QSDSVPEKPL  720
SCQQASRNMP CKSQGGSTRS CKKVHKQGIA LGRSVDLTKF NGYEELIAEL DDMFDFNGEL  780
KGPNKDWMVV YTDNEGDMML VGDDPWIEFC DMVHKIFIYT REEVQRMNPG TLNSRSEDSH  840
ANSMERSSVG REMRGCLSTS SLNSDNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-175353922354Auxin response factor 1
4ldw_A1e-175353922354Auxin response factor 1
4ldw_B1e-175353922354Auxin response factor 1
4ldx_A1e-175353922354Auxin response factor 1
4ldx_B1e-175353922354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB11G21910.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under light or dark conditions and gravitropic stimulation of coleptile. {ECO:0000269|PubMed:12369618, ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3063060.0AJ306306.1 Oryza sativa subsp. japonica mRNA for auxin response factor 1 (arf1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697998.10.0PREDICTED: auxin response factor 23
SwissprotQ2R3F50.0ARFW_ORYSJ; Auxin response factor 23
TrEMBLJ3N8Q50.0J3N8Q5_ORYBR; Auxin response factor
STRINGOB11G21910.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117836111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Contreras I,Ortiz-Zapater E,Castilho LM,Aniento F
    Characterization of Cop I coat proteins in plant cells.
    Biochem. Biophys. Res. Commun., 2000. 273(1): p. 176-82
    [PMID:10873582]
  2. Kobayashi-Uehara A,Shimosaka E,Handa H
    Cloning and expression analyses of cDNA encoding an ADP-ribosylation factor from wheat: tissue-specific expression of wheat ARF.
    Plant Sci., 2001. 160(3): p. 535-542
    [PMID:11166441]
  3. Ren H, et al.
    Combinative effects of a bacterial type-III effector and a biocontrol bacterium on rice growth and disease resistance.
    J. Biosci., 2006. 31(5): p. 617-27
    [PMID:17301500]
  4. Song Y,You J,Xiong L
    Characterization of OsIAA1 gene, a member of rice Aux/IAA family involved in auxin and brassinosteroid hormone responses and plant morphogenesis.
    Plant Mol. Biol., 2009. 70(3): p. 297-309
    [PMID:19266169]
  5. Kitajima A, et al.
    The rice alpha-amylase glycoprotein is targeted from the Golgi apparatus through the secretory pathway to the plastids.
    Plant Cell, 2009. 21(9): p. 2844-58
    [PMID:19767453]
  6. Kishimoto N, et al.
    Identification of the duplicated segments in rice chromosomes 1 and 5 by linkage analysis of cDNA markers of known functions.
    Theor. Appl. Genet., 1994. 88(6-7): p. 722-6
    [PMID:24186168]
  7. Sugano SS, et al.
    CRISPR/Cas9-mediated targeted mutagenesis in the liverwort Marchantia polymorpha L.
    Plant Cell Physiol., 2014. 55(3): p. 475-81
    [PMID:24443494]
  8. Kaneko K, et al.
    N-Glycomic and Microscopic Subcellular Localization Analyses of NPP1, 2 and 6 Strongly Indicate that trans-Golgi Compartments Participate in the Golgi to Plastid Traffic of Nucleotide Pyrophosphatase/Phosphodiesterases in Rice.
    Plant Cell Physiol., 2016. 57(8): p. 1610-28
    [PMID:27335351]