PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G17130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 596aa    MW: 66391.2 Da    PI: 7.0584
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G17130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK919e-29272322252
        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   ek+isl++l++yFs+++kdAAk++gvc T+LKriCRq+GI+RWP+Rki+++
  OB11G17130.1 272 EKSISLNVLQQYFSGSLKDAAKSIGVCRTTLKRICRQHGISRWPSRKINKV 322
                   799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.927261342IPR003035RWP-RK domain
PfamPF020429.8E-26275322IPR003035RWP-RK domain
SuperFamilySSF542771.35E-21492584No hitNo description
Gene3DG3DSA:3.10.20.2401.4E-20499583No hitNo description
SMARTSM006661.8E-21502585IPR000270PB1 domain
PROSITE profilePS5174522.582502585IPR000270PB1 domain
PfamPF005644.3E-17503584IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
METFQSYTRN QKLAFLEIFD VLRTVCEAHL LPLALAWIPV CFKRGVHVAA EYGDQGAKFG  60
TRNKQVLCIH ESACYVNDTR MCDFVQICAE HPLEKGQGVA GNAFLSNNPF FSSDVKDYDM  120
HAYPLAIHAR KFGLHAAVAI RLRSTYTGND DYVLEFFPVL CKGCEEQQLL LDSISATMRK  180
VCKSLRTVSD AEFKKDATTK PSNDNGSGKR CSSPINLIYS GQNIDVSDQI KTNMPLGYQI  240
ESTNKQLADK NISNKLICSN ACGGEKRRSS TEKSISLNVL QQYFSGSLKD AAKSIGVCRT  300
TLKRICRQHG ISRWPSRKIN KVNRSLKKIQ NVISTVHGVD GLLKYDLSTG CLVSSSIEPV  360
LVNVEHKGSN PLPNESEVSH LKFKLDRDTY QREHLGQDVM HNGQNGEIDF DMDDGPLCED  420
MSTCAAKTGA RTERQEHKPV SRDYSSAPEQ YRMESDTDKS NKNVEQSVPS SSSMTDCSSG  480
SASSDGTFKS LKSQPVSESS MAIVVKATYK NDTIRFKLLL PSAKYEELLE EIVKRLKLSL  540
GTFHLKYTDD EGDSVVLESD DDLHECLEML DATRLHILKL QVQEALLEVR QVAVPC
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB11G17130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0648590.0AK064859.1 Oryza sativa Japonica Group cDNA clone:J013000H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697622.10.0PREDICTED: LOW QUALITY PROTEIN: protein NLP2
TrEMBLJ3N7C70.0J3N7C7_ORYBR; Uncharacterized protein
STRINGOB11G17130.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-107Nin-like family protein