PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G15450.1
Common NameLOC102700838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 355aa    MW: 39467.7 Da    PI: 9.8855
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G15450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.55e-072242691762
                   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                   A+rsR RK+++i+eLe+kv++L++e  +   e+e l+++   l+ e
  OB11G15450.1 224 AQRSRVRKLQYIAELERKVQALQSEGIDVSAEMEFLSQQNIMLDLE 269
                   89***********************999999999888887666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-5213272IPR004827Basic-leucine zipper domain
CDDcd147039.95E-16214264No hitNo description
SuperFamilySSF579595.63E-6223266No hitNo description
Gene3DG3DSA:1.20.5.1703.6E-6224266No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MMANAKLPKQ ALLPPRSPFP TAAPSPYAGD HHGPIARPQG AAHHRHGHHH QRTSSESFID  60
EQPSWLDDLL NEPETPVRQH GRAGHRRSSS DSFALFDGSS AAGAYANGFE GMGGGGQAAP  120
WGGVQEYYAK PGSFGRHQGR PWEQGMGNLV NYRQGGGPPM PAKEKVGGHH GSVSVLRDHD  180
HGMDRRSSDE SGHDQKVGAE RKEGVPPKHA QSEADTKRAK QQYAQRSRVR KLQYIAELER  240
KVQALQSEGI DVSAEMEFLS QQNIMLDLEN KALKQRLESL AQEQLIKRFQ QEMFEREIGR  300
LRSLYQQQQQ QKQPQPTTPL NRSNSRDLDL QFANLSLKHK DPNSGRDAVS GSLRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0722670.0AK072267.1 Oryza sativa Japonica Group cDNA clone:J023004I18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662832.20.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLJ3N6V90.0J3N6V9_ORYBR; Uncharacterized protein
STRINGOB11G15450.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.27e-67bZIP family protein