PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G12850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 202aa    MW: 23544.3 Da    PI: 12.1027
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G12850.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.7e-11668163
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                  eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke +   +e+ +lk  +
  OB11G12850.1  6 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNETMKKEKDVVMQEYLSLKETN 68
                  89**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.8E-9668IPR004827Basic-leucine zipper domain
SMARTSM003381.2E-12670IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979871IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-51074No hitNo description
SuperFamilySSF579591.2E-71066No hitNo description
CDDcd147029.59E-91161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MLTEAEKEAK RLRRVLANRE SARQTILRRQ AIRDELARKV ADLSSQNETM KKEKDVVMQE  60
YLSLKETNKQ LKEQVAIRTS KKVAASVAEP MDVSPXXXXX XXXXXXXXXX XXXXXXXXXX  120
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX RRRRTRSRSK  180
SSRRAAPAAG RPRRTPTTTR AR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2879051e-117AK287905.1 Oryza sativa Japonica Group cDNA, clone: J065211O07, full insert sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.13e-18bZIP family protein