PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G12100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 370aa    MW: 40745.2 Da    PI: 6.5071
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G12100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1441.5e-446230120276
          GRAS 120 sqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL....rvkpgEalaVnlvlqlh 211
                   +q+ QW+ Ll++L  Rp+ pp  +R+T++++    ++e l +++e L++ Aeel+++f+f+  v+ +ledl++ +L    ++k+gEalaV++ lqlh
  OB11G12100.1   6 TQPCQWIQLLHELRRRPGRPPhVVRLTVIHD----DEELLAKMAELLHDEAEELDMEFQFHG-VVGQLEDLDFGNLhnvlEIKSGEALAVSCTLQLH 97 
                   799**************7777478*******....9**************************.7999****9988765558899************* PP

          GRAS 212 rll........................................................................desvsleserdevLklvkslsP 236
                   rll                                                                        + ++    +  ++L++v+ lsP
  OB11G12100.1  98 RLLaaeddatyssrsahlnqmasiaqlqhmaaassrqpssssdcgsvqykddddsfqspgtplafvsppastphfHTPA----PLASFLSAVRALSP 190
                   ********************************************************************98755444444....5556********** PP

          GRAS 237 kvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                   k+vvv+eq+adhn++sF +rf+eal++y+a+fdsl+a ++
  OB11G12100.1 191 KIVVVAEQDADHNGASFRKRFCEALHHYAAVFDSLDAAAA 230
                   ***********************************87654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098520.391369IPR005202Transcription factor GRAS
PfamPF035145.3E-426230IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MSGPATQPCQ WIQLLHELRR RPGRPPHVVR LTVIHDDEEL LAKMAELLHD EAEELDMEFQ  60
FHGVVGQLED LDFGNLHNVL EIKSGEALAV SCTLQLHRLL AAEDDATYSS RSAHLNQMAS  120
IAQLQHMAAA SSRQPSSSSD CGSVQYKDDD DSFQSPGTPL AFVSPPASTP HFHTPAPLAS  180
FLSAVRALSP KIVVVAEQDA DHNGASFRKR FCEALHHYAA VFDSLDAAAA PXXXXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX ARAARPAAAL  300
GGAHGDGRVH GRPAELRRHQ ARERHAAAVW TATRREQGMQ RMPPPVLELE ASLLGVRMAA  360
GGEQSVGVRF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3780320.0FQ378032.1 Oryza brachyantha chromosome 11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619131.11e-126PREDICTED: scarecrow-like protein 3
TrEMBLG2XM721e-157G2XM72_ORYBR; Hypothetical_protein
STRINGOB11G12100.11e-155(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.16e-20scarecrow-like 3