PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G11270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ZF-HD
Protein Properties Length: 150aa    MW: 16223.8 Da    PI: 11.0064
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G11270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer811.4e-252876251
   ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRn 51
                  + vrY+eC++NhAas+GghavDGC+Efm+s g++gta al CaACg HR+
  OB11G11270.1 28 KVVRYRECQRNHAASIGGHAVDGCREFMAS-GADGTAPALLCAACGRHRS 76
                  579**************************9.999***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-153076IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.6E-243076IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.6E-213176IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.6383281IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MGPQQDRSAA KPYANGTAAP APGRKENKVV RYRECQRNHA ASIGGHAVDG CREFMASGAD  60
GTAPALLCAA CGRHRSXXXX XXXXXXXXXX XXXXXXXXXX XXGGRSRPPP NATAPPTPPP  120
APAGDRRELV RLQTRASRSG IQDQQVRYLH
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB11G11270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235252e-88AC123525.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0056E15, complete sequence.
GenBankAK0637152e-88AK063715.1 Oryza sativa Japonica Group cDNA clone:001-120-C04, full insert sequence.
GenBankAP0149672e-88AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCP0126192e-88CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankCU4056102e-88CU405610.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C006D05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663173.11e-48PREDICTED: mini zinc finger protein 1-like
SwissprotB8BLT33e-31MIF2_ORYSI; Mini zinc finger protein 2
SwissprotB9GBM33e-31MIF2_ORYSJ; Mini zinc finger protein 2
TrEMBLJ3N5P11e-78J3N5P1_ORYBR; Uncharacterized protein
STRINGOB11G11270.12e-79(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.17e-21mini zinc finger 1