PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G23730.1
Common NameLOC102713023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 277aa    MW: 30487.8 Da    PI: 5.475
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G23730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.11e-09125183563
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                   kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ l +++
  OB10G23730.1 125 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGLATQN 183
                   999*******************************************9998888776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16121185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714123186IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.0E-11125182No hitNo description
SuperFamilySSF579595.94E-11125175No hitNo description
PfamPF001702.6E-9125183IPR004827Basic-leucine zipper domain
CDDcd147031.26E-19126175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MSMEGMAADG LNNNSDGDSR GSSMRTNGAD SSENESEDYV GADSQVLLWG GEAAGKKRRN  60
AAGEPAARHA RSLSMDSLMG KLSFAANGEP AKFSLDFGSG EFTPAEMKRI MADEKLAEMA  120
LADPKRVKRV LANRQSAARS KERRMRYIAE LEQKVQILQT EATTLSAQLT LLQRDSSGLA  180
TQNNELKFRL QSMEQQAQLR DALNEALSAE VQRLKLAANE VGDTSSSSNL AHQIQLRCQS  240
QMLDLHNQQQ QQQAEQIPFY QLEQPEQNGA ARNHESK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086070.0AK108607.1 Oryza sativa Japonica Group cDNA clone:002-146-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006661991.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ6S4P43e-51RF2B_ORYSJ; Transcription factor RF2b
TrEMBLJ3N4C50.0J3N4C5_ORYBR; Uncharacterized protein
STRINGOB10G23730.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.39e-59bZIP family protein