PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G16230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 328aa    MW: 37572.8 Da    PI: 4.9902
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G16230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.4e-1960113356
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k++++ +eq+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  OB10G16230.1  60 KKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 113
                   4557899**********************************************9 PP

2HD-ZIP_I/II125.72e-4059151193
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   ekkrrl++eqv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal+ e ++L++++++L++e++e
  OB10G16230.1  59 EKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFAALRSRHDALRLECDSLRRDKDALAAEIME 151
                   69**************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.12E-1854117IPR009057Homeodomain-like
PROSITE profilePS5007116.55255115IPR001356Homeobox domain
SMARTSM003891.6E-1858119IPR001356Homeobox domain
PfamPF000464.2E-1660113IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.3E-1960118IPR009057Homeodomain-like
CDDcd000865.11E-1360116No hitNo description
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PfamPF021831.4E-14115156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAILQDTSDQ QDQEDMRYTA ERQDHRVDAA AAAYEEEEEE EDDDEEVGRG GGGSGGLGEK  60
KRRLAAEQVR ALERSFEADN KLDPERKARI ARDLRLHPRQ VAVWFQNRRA RWKTKQIERD  120
FAALRSRHDA LRLECDSLRR DKDALAAEIM ELREKVDKQM SVKLETGDEQ PTLASGGXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXPPPASSPP ARSTAAGYPG TGPRVGSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107115RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB10G16230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8376741e-149CT837674.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA120C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662305.21e-121PREDICTED: homeobox-leucine zipper protein HOX8-like
SwissprotQ338Z78e-63HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLJ3N2751e-117J3N275_ORYBR; Uncharacterized protein
STRINGOB10G16230.11e-118(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.25e-38homeobox protein 5
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]