PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G12550.1
Common NameLOC102714771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 251aa    MW: 28950.8 Da    PI: 6.9494
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G12550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.88.4e-322178259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                  +Dgy+WrKYGqK vk+s +prsYYrCt + C vkk+vers++d ++v++tYeg+H+h+
  OB10G12550.1 21 EDGYRWRKYGQKAVKNSSYPRSYYRCTAPWCGVKKRVERSQQDASMVITTYEGQHTHP 78
                  8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182902.35E-271680IPR003657WRKY domain
SMARTSM007742.5E-372079IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.5E-302080IPR003657WRKY domain
PfamPF031066.6E-262178IPR003657WRKY domain
PROSITE profilePS5081128.5642180IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MTAAGGECSF PLPLWSLYAC EDGYRWRKYG QKAVKNSSYP RSYYRCTAPW CGVKKRVERS  60
QQDASMVITT YEGQHTHPSP VSYHVHRHHA AGLMAAAGFA TPPPPLLRFC MPRRRRPRLP  120
RGDDEPTADE LRRAQHTVRR PADDDDEPTA DELRRAQHTV RRPADDDDEP TADELRRAQH  180
TVRRPADDDD EPTADELRRA QHTVRRPADD DDEPTADELR RAQHTVRRPA DDDDASSSIC  240
YEWRTRSKEH Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A7e-2319801374WRKY transcription factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB10G12550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1095682e-83AK109568.1 Oryza sativa Japonica Group cDNA clone:002-130-E04, full insert sequence.
GenBankAY8706002e-83AY870600.1 Oryza sativa (japonica cultivar-group) WRKY8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662206.10.0PREDICTED: probable WRKY transcription factor 27
TrEMBLJ3N1570.0J3N157_ORYBR; Uncharacterized protein
STRINGOB10G12550.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.14e-30WRKY DNA-binding protein 48