PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G25360.1
Common NameLOC102722895
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 841aa    MW: 92453.7 Da    PI: 6.5965
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G25360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.5e-29525575252
        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   ek++sl++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  OB09G25360.1 525 EKTVSLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGINRWPSRKIKKV 575
                   799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.848514595IPR003035RWP-RK domain
PfamPF020429.7E-26527575IPR003035RWP-RK domain
SuperFamilySSF542771.6E-20733829No hitNo description
Gene3DG3DSA:3.10.20.2401.4E-23743823No hitNo description
PROSITE profilePS5174518.316743826IPR000270PB1 domain
SMARTSM006663.2E-17743826IPR000270PB1 domain
PfamPF005644.0E-15744823IPR000270PB1 domain
CDDcd064071.36E-41744823No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MEEGDPQPSI SLARTPSEGA PAVDLDLLEQ LLSADNAWLE VAANTSRSNN FFASPSNLLT  60
DAVTTTTPAN SWWIQPSGAS TSVRERFDQA LAYIRETQSD ADVLVQLWVP IKGDGGQLVL  120
TTSGQPFTLD QRSNSLIQFR EVSTKYQFSA DVASGSSPGL PGRVFIGRLP EWSPDVRYFT  180
SYEYPRVSHA QYLDVHGTMG LPVFERGNYS CLGVIELIMT KQKLNFTSEI NTICSALQAV  240
NLTSTEVSSI PRTKLSSASY KDALPEILEV LRAACITHKL PLAQTWVTCA QQGKRGSRHS  300
DENYRYCIST IDEACYVNES QMQSFHDACS EHHLLRGQGV AGKAFTTNQP CFLPDIGSST  360
KLEYPLSHHA KIFNLKGAVA IRLRCTRTGI ADFVLEFFLP TDCEVLEEQK AVLDSLSGTM  420
RNVCQTLRVV TDKEMEDETM REMNELNSFS PRGKNKVEEL SFGGNTTEHR EEASWTGLVG  480
TSQNGSDLAE LHTHGMLSHG GQGSSQAGDQ TSKESSKIKR RTKTEKTVSL QVLRQYFAGS  540
LKDAAKSLGV CPTTLKRICR QHGINRWPSR KIKKVDHSLR KLQQIIDSVH GAETAFQLNT  600
LYKDLTNTSV SSDNNLSGSI TVPLANQSNL TDFEKQQHHM PSNNIPSTSL SHSSCSQSSD  660
SSPSCSGVAT KHSPQVGANL VKSGCLPQHS PVQTQQTEAA SVNEHFSGQE ATIDLLQDVA  720
EKAIDGHHTS QSPSSPKQTA DVGMRVKATF GSEKVRFRLK SECGFQELKQ EISKRLSIVD  780
MNSLIVKYLD DDSEWVLMTC DADLHECFHV YKQADIQTIK ISVYLAPSPT TRVTIGHTGL  840
S
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB09G25360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015696829.10.0PREDICTED: protein NLP1-like
RefseqXP_015696830.10.0PREDICTED: protein NLP1-like
RefseqXP_015696831.10.0PREDICTED: protein NLP1-like
TrEMBLJ3MZV70.0J3MZV7_ORYBR; Uncharacterized protein
STRINGOB09G25360.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein