PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G24570.1
Common NameLOC102705558
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 191aa    MW: 20617.1 Da    PI: 10.2233
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G24570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_156.94.5e-18121174457
                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                   ++r +r++kNRe+A rsR+RK+a++ +Le +v++L++eNk+L+ + e+l+k+v+
  OB09G24570.1 121 DRRKKRMIKNRESAARSRARKQARVNNLEAEVEQLKQENKMLRVKYEQLRKTVE 174
                   789************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-12118185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.944120174IPR004827Basic-leucine zipper domain
PfamPF001705.6E-16121174IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.8E-16121174No hitNo description
SuperFamilySSF579599.38E-13122174No hitNo description
CDDcd147071.72E-20122172No hitNo description
PROSITE patternPS000360125140IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAMEDNEDMW ANTSSPSASP PGPTAGEGGF ISTALSLNST HLHGLLSSSF VAADPPSHAG  60
SNNDDSSGYR NAAPTSSFFP PASYHYHGHP LAPPPAPLDA ARRAFELNMC AAGAGAPAAG  120
DRRKKRMIKN RESAARSRAR KQARVNNLEA EVEQLKQENK MLRVKYEQLR KTVEVPVPVR  180
RTLQRVLSAP F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8359081e-136CT835908.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN083I14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660911.21e-139PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLJ3MZM81e-139J3MZM8_ORYBR; Uncharacterized protein
STRINGOB09G24570.11e-138(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.21e-09basic region/leucine zipper motif 27