PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G20760.1
Common NameLOC102704732
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 681aa    MW: 73696.6 Da    PI: 6.657
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G20760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.61.7e-30269325259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   +Dgy+WrKYGqK+vk++e+prsYY+Ct++ C+v+kkve ++ d+++++i+Y+g Hnh+
  OB09G20760.1 269 EDGYSWRKYGQKQVKNNENPRSYYKCTQTACTVRKKVEYAQ-DGQITQIIYKGAHNHP 325
                   8**************************************99.***************8 PP

2WRKY1048.2e-33482540159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d k v++tYeg+Hnhe
  OB09G20760.1 482 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCSVRKHVERASHDLKSVITTYEGKHNHE 540
                   59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.2E-28258327IPR003657WRKY domain
PROSITE profilePS5081123.319263327IPR003657WRKY domain
SuperFamilySSF1182903.14E-24266327IPR003657WRKY domain
SMARTSM007745.5E-32268326IPR003657WRKY domain
PfamPF031062.8E-23269325IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-37467542IPR003657WRKY domain
SuperFamilySSF1182906.41E-29474542IPR003657WRKY domain
PROSITE profilePS5081137.883477542IPR003657WRKY domain
SMARTSM007743.3E-38482541IPR003657WRKY domain
PfamPF031062.8E-25483540IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MAGTSDHGSL MEDWMPPPTP SPRTIMSSFL NDDFVSGSFG NFFSEHESNK PQDQFERGRE  60
LVGLSKEVSS QSARPTFQKD ASLEPSLLNP TQRSNSHGGL AERRAARAGF SVPKIDTSRA  120
GSSTVVRSPV AIPPGLSPTT LLESPVFLYN AMAQPSPTTG KLPFLMGTNA KSTIPPTTKM  180
DEDCAFGNDT FSFQPHVGSR LPNFAAAEKE SSLQSSFTAV KDTSDEKIVK TKISDSKFGD  240
NHSFSDEQED DETNQNGEFS SAAMCSPAED GYSWRKYGQK QVKNNENPRS YYKCTQTACT  300
VRKKVEYAQD GQITQIIYKG AHNHPMPPPN HRSGVPLSHT NDLEVNVLDN RGPQAGLNSA  360
SLWNNSKNDS LQDVQSEVIE TTTAACRPQS SNCDTSIMES QDAVDVSSTL SNEDDRATHG  420
TASIECSGDG DETDSKRRKL DALTAATAAI TTTSNIDMGV AASRGVREPR VVVQTTSEVD  480
ILDDGYRWRK YGQKVVKGNP NPRSYYKCTH QGCSVRKHVE RASHDLKSVI TTYEGKHNHE  540
VPAARNSGHG SSGSGSAPSA PQVNSSQRRQ EPAQASFGQF GGTAPFSSFV LPPRNQFGPA  600
ASNFAFGMVP PGMAIPMPPL GPLAPTKMVG HPSTMQGFQG LMMPEGEMKT EPMLRPSFPA  660
VNQSSSSFQQ MMNRPPFGPQ M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-36269543878Probable WRKY transcription factor 4
2lex_A6e-36269543878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB09G20760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0650780.0AK065078.1 Oryza sativa Japonica Group cDNA clone:J013001K23, full insert sequence.
GenBankAK1037450.0AK103745.1 Oryza sativa Japonica Group cDNA clone:J033138N11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660749.10.0PREDICTED: probable WRKY transcription factor 3 isoform X2
TrEMBLJ3MYJ70.0J3MYJ7_ORYBR; Uncharacterized protein
STRINGOB09G20760.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-112WRKY DNA-binding protein 2