PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G19140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 370aa    MW: 39600.9 Da    PI: 9.7288
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G19140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.71.2e-13291337551
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                   +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ Nk+L  +  e
  OB09G19140.1 291 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKELNKELERKQAE 337
                   79************************************988765444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-11287352IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76289340IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-13291339No hitNo description
SuperFamilySSF579597.5E-10291339No hitNo description
PfamPF001701.0E-11291339IPR004827Basic-leucine zipper domain
CDDcd147072.24E-24291343No hitNo description
PROSITE patternPS000360294309IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MLTDRWGGRR EAMEFKNGGS SSERRAPAAE GTTLARQGSV YSLTFDEFQS ALGGGGGGGS  60
GFGKDFGSMN MDELLRSIWT AEESQAMASA SGSAAGVGMG VGAPPTSLQR QGSLTLPRTL  120
SAKTVDEVWR NLVRDEPPPV GADGGEMPPP RQATLGEMTL EEFLVRAGVV RENPPATPTV  180
PPPPMPPRPV PVVPKTTAFL GNFPGANDVG AAALGFAPLG LGDPTLGNGL MPRAVGLPGG  240
AIAMQAAVNQ FDSGDKGNSD LSSPTEPMPY SFEGLVRGRR NGAGVEKVVE RRQRRMIKNR  300
ESAARSRARK QAYTMELEAE VQKLKELNKE LERKQAEIME VQKNEVEEMI KDPFGRRKRL  360
CLRRTLTGPW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658730.0AK065873.1 Oryza sativa Japonica Group cDNA clone:J013049N23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015696857.10.0PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ6ZDF31e-104TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLJ3MY350.0J3MY35_ORYBR; Uncharacterized protein
STRINGOB09G19140.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.15e-35ABA-responsive element binding protein 3