PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G14940.1
Common NameLOC102707060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 293aa    MW: 31199.3 Da    PI: 5.4726
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G14940.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26076.16.3e-2418318100
        DUF260  18 lapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                   +apyfpa+q+++f n+h+lFG++n++++l++++++ ++dam++l+yeA+ ra dPv Ga++vi++  +++++l +el++++e+
  OB09G14940.1   1 MAPYFPADQQRRFLNAHRLFGVRNIQRTLQRTRPDLQSDAMQALTYEANSRAADPVGGAARVISEPAEHYKTLCKELVAVHEK 83 
                   59****************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.17184IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-21181IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAPYFPADQQ RRFLNAHRLF GVRNIQRTLQ RTRPDLQSDA MQALTYEANS RAADPVGGAA  60
RVISEPAEHY KTLCKELVAV HEKLELCRPQ QAAAAAARDT LIANDPLADP ASAMLFAGAG  120
AVAGPSQNEE DAMVDAFYAD QPAVGESSNV QAGGGFQEQY IKDESQVQPP PQQHYEHLYH  180
GAAGDEGSSH AWISSVVGNV QHCGDGEEQP MGLSDQLRPH FQIEAAAFDV KAAALARTTD  240
QHHGNATFKQ PEQKVVASSS AAAAGSSSSS AAHCQLQFGC SSNAWNNVGA HVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-1218428111LOB family transfactor Ramosa2.1
5ly0_B2e-1218428111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB09G14940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2406529e-31AK240652.1 Oryza sativa Japonica Group cDNA, clone: J023098G11, full insert sequence.
GenBankAP0053889e-31AP005388.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0086F04.
GenBankAP0149649e-31AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126169e-31CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006661168.20.0PREDICTED: LOB domain-containing protein 20-like
TrEMBLJ3MWW50.0J3MWW5_ORYBR; Uncharacterized protein
STRINGOB09G14940.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP182931010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.11e-18LOB domain-containing protein 7