PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G29600.1
Common NameLOC102700550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 163aa    MW: 17080.8 Da    PI: 8.2218
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G29600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1506.4e-16871361160
                   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                   +kNRe+A rsR+RK+a+++eLe++v  L aeN +L+++ +elk +++k +
  OB08G29600.1  87 MKNRESAERSRARKQAYLQELEQEVRLLRAENATLRDQCDELKALAEKAE 136
                   9*******************************************999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.5E-587141IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-1187129No hitNo description
Gene3DG3DSA:1.20.5.1705.1E-1287133No hitNo description
PfamPF001701.2E-1287135IPR004827Basic-leucine zipper domain
CDDcd147071.71E-1387130No hitNo description
PROSITE profilePS5021710.05988129IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MERAVTGTAG SSGGDDELVL PPAASEDALG LRLPSSRSYS SSGGGAGGAA GRRLAASLEQ  60
ELLYRAELHQ QQVASGGGGG RGGGGAMKNR ESAERSRARK QAYLQELEQE VRLLRAENAT  120
LRDQCDELKA LAEKAETEAP APAPTKPTCR GRHSRRSDQP VNL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17884GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660364.11e-110PREDICTED: G-box-binding factor 4-like
TrEMBLJ3MV291e-110J3MV29_ORYBR; Uncharacterized protein
STRINGOB08G29600.11e-110(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151931719