PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G29120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 282aa    MW: 31048.5 Da    PI: 6.8161
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G29120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.49.9e-11136193562
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                   kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +  l ++
  OB08G29120.1 136 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDSTGLATQ 193
                   899******************************************9999877766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-18132196IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.829134197IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.73E-12136187No hitNo description
Gene3DG3DSA:1.20.5.1706.1E-12136193No hitNo description
PfamPF001701.5E-9136194IPR004827Basic-leucine zipper domain
CDDcd147031.51E-19137188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDLDGMEALN SSEERYEDRD SRASGTRAGS VADSSENEAE SHSTSMERKD GGKSRHCRSL  60
SVDSLIGKLN FAGDESPKLP LPSPSGGLSR SGSGSLDGGA ASLFGAEFAN GEFTEAEKKK  120
IMANERLAEI ALTDPKRVKR ILANRQSAAR SKERKMRYIQ ELEHKVQVLQ TEATTLSAQL  180
TMLQRDSTGL ATQNNELKIR LQAMEQQAQL RDALNEALTA EVQRLKLATG EITDGRMSKG  240
LQQQMNSQLI QLQQLQIQQQ QQQQQSSQTT QQSQQQQPQK SA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660351.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ6S4P45e-55RF2B_ORYSJ; Transcription factor RF2b
TrEMBLJ3MUY10.0J3MUY1_ORYBR; Uncharacterized protein
STRINGOB08G29120.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-76bZIP family protein