PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G27360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 234aa    MW: 25873.6 Da    PI: 6.2594
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G27360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.14.5e-3668166199
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaC++lrr+Ca+dCvlap fpa++p+++ +vh +FGasnv +ll++lp  er +a++++++eA +r++dPvyG++g+i++lq +++ ++ ela++
  OB08G27360.1  68 RCAACRYLRRRCADDCVLAPFFPASRPHRYFCVHTVFGASNVARLLQSLPMAERGNAANTMAMEAYWRVQDPVYGCTGIINRLQDEIRAVQCELART 164
                   6*********************************************************************************************998 PP

        DUF260  98 ke 99 
                   ++
  OB08G27360.1 165 QA 166
                   76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.57567168IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-3668165IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MDSSITRLQL ADLLLPCMPC KYIRWKDLGV SSPNPAKIVR SKTGDIMPEN DDDDDRPPPP  60
PPHPAARRCA ACRYLRRRCA DDCVLAPFFP ASRPHRYFCV HTVFGASNVA RLLQSLPMAE  120
RGNAANTMAM EAYWRVQDPV YGCTGIINRL QDEIRAVQCE LARTQALLAI ALAAAASRQL  180
QPPPPPPPQQ DRAGGRPVVV VVRGQQQQEE EEEQSPPAPS LMDPADEYLN LDGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-286916712112LOB family transfactor Ramosa2.1
5ly0_B8e-286916712112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB08G27360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1070787e-68AK107078.1 Oryza sativa Japonica Group cDNA clone:002-121-F06, full insert sequence.
GenBankAP0047087e-68AP004708.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0700D12.
GenBankAP0047617e-68AP004761.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0686C03.
GenBankAP0149647e-68AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126167e-68CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660281.11e-90PREDICTED: LOB domain-containing protein 24-like
TrEMBLJ3MUF51e-169J3MUF5_ORYBR; Uncharacterized protein
STRINGOB08G27360.11e-170(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-23LBD family protein