PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G27190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 996aa    MW: 109972 Da    PI: 7.1041
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G27190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.7e-4156133178
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   +Cqv++C+adl++ak+yhrrhkvCe+h ka+++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  OB08G27190.1  56 MCQVDDCRADLTNAKDYHRRHKVCEMHGKASKALVGNQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 133
                   6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3449118IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.16354131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-3855134IPR004333Transcription factor, SBP-box
PfamPF031104.5E-3057130IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 996 aa     Download sequence    Send to blast
MVVSPAATMS SSPSPPASSA PAQEPVVRPS KRVRSGSPGS ASGGGGGGNS GGSYPMCQVD  60
DCRADLTNAK DYHRRHKVCE MHGKASKALV GNQMQRFCQQ CSRFHPLSEF DEGKRSCRRR  120
LAGHNRRRRK TQPTDVASQL LLPGNQENAA NRTQDIVNLI TVIARLQGGN VGKLPSIPPI  180
PDKDNLVQII SKINSINNVN SASKSPPSEA VDLNATQGQH QDSVQRTTNG FEKQTNGFDK  240
QTVPSTMDLL TVLSTALATP NPDSNTSQSQ GSSDSSDNNK SKSHSTEPAN VVSSHEKSIR  300
VFSATRTNGI LESPPEVYKQ PEQETRPYLS LRLFGSTEED VPCKMDTANK YLSSESSNPL  360
DERSPSSSPP ITHKFFPIRS VHEEDRIADY GEDTATVEVS TSRAWHAPPL ELFKDSERPI  420
ENGSPPNPAY QSCYTSTSCS DHSPSTSNSD GQDRTGRIIF KLFGKEPSTI PGNLRGEIVN  480
WLKHSPTEME GYIRPGCLVL SIYLSMPTIA WDELQENLLQ RVNTLVQGSD LDFWRKGRFL  540
VRTDTQLVSY KDGTTRLSKS WRTWNTPELT FVSPIAVVGG RKTSLILKGR NLTIPGTQIH  600
CTNTGKYISK EVLCSAYPGT IYDDSGVETF DLPGEPHLVL GRYFIEVENR FRGNSFPVII  660
ANSSVCQELR SLEAELEGSQ FVDGSSDDQA HDARQLKPKD EVMHFLNELG WLFQKVAASA  720
SDGKSDPSVL DVIYFSTARF RYLLLFSSER DWCSLTRTLL EILVKRSLAS DELSQETLDM  780
LSEIHLLNRA VKRKSSQMAR LLVQFVVLCP DDSKLYPFLP NVAGPGGLTP LHLAASMEDA  840
EDIVDALTDD PQQVGLSCWH SVLDDDGQSP ETYAKLRNNN SYNELVAQKL VDRKNHQVTI  900
MVGKEEIHMD QPGNVGEKNK SAIQALQIRS CNQCAILDSG LLRRPLHSRG LLARPYIHSM  960
LAIAAVCVCV CVFMRALLRF NSGRTFKWER LDFGTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-3345130184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00664PBMTransfer from Potri.002G002400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2420700.0AK242070.1 Oryza sativa Japonica Group cDNA, clone: J075133L10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659584.20.0PREDICTED: squamosa promoter-binding-like protein 15, partial
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLJ3MUD80.0J3MUD8_ORYBR; Uncharacterized protein
STRINGOB08G27190.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14