PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G25840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 109aa    MW: 12229.7 Da    PI: 10.9711
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G25840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.17.1e-121511060
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
                  + +NRe+ArrsR RK+ ++ eL   v+ L + N++L +el++    +a ++
  OB08G25840.1  1 MVSNRESARRSRMRKQRQLSELWAQVEHLRGANRRLLDELNRALRGCADVR 51
                  579*************************************99877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001701.1E-8147IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-9144No hitNo description
CDDcd147027.94E-10145No hitNo description
PROSITE profilePS502178.737157IPR004827Basic-leucine zipper domain
SMARTSM003387.5E-4356IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-7346No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MVSNRESARR SRMRKQRQLS ELWAQVEHLR GANRRLLDEL NRALRGCADV RRESSRLRDE  60
KAELIKKLQL LPQPAPEKNA SSPSASSNHG SSCSSEPCKN STTTTTAAE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1815RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8315042e-94CT831504.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA115A07, full insert sequence.
GenBankCP0126162e-94CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankAP0149642e-94AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0045572e-94AP004557.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0028A08.
GenBankAP0043762e-94AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695647.15e-72PREDICTED: basic leucine zipper 63
SwissprotQ9FMC23e-15BZP43_ARATH; Basic leucine zipper 43
TrEMBLJ3MU038e-73J3MU03_ORYBR; Uncharacterized protein
STRINGOB08G25840.12e-72(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-17basic leucine-zipper 42