PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G24950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 211aa    MW: 22475.5 Da    PI: 10.0086
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G24950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.21.3e-16125179559
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                   +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ ee+ ++ ++l
  OB08G24950.1 125 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNMELQKKQEEMMEMQKNL 179
                   79*********************************************99998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-14121185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.197123174IPR004827Basic-leucine zipper domain
CDDcd147077.32E-26125177No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-15125178No hitNo description
SuperFamilySSF579596.88E-12125179No hitNo description
PfamPF001702.4E-14125179IPR004827Basic-leucine zipper domain
PROSITE patternPS000360128143IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MDLKDGGGSE RRGAAGAGVG AAVNNSSIFF GNFGGANDAA GAGVMGFSPV GIGDPTMGNG  60
LMSGAAGMGG GGITVASVDT SVGPMDSVGR GDGDLSSPMA PVPYPFEGVI RGRRSGGIEE  120
KVVERRQRRM IKNRESAARS RARKQAYTME LEAEVQKLKE QNMELQKKQE EMMEMQKNLF  180
PEMQKNQVSE VVNNPYGQKK RCLRRTLTGP W
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3234820.0AY323482.1 Oryza sativa (japonica cultivar-group) bZIP transcription factor (aba1) mRNA, complete cds.
GenBankAB0232880.0AB023288.1 Oryza sativa Japonica Group mRNA for TRAB1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659491.21e-137PREDICTED: bZIP transcription factor TRAB1-like, partial
SwissprotQ6ZDF31e-111TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLJ3MTR41e-152J3MTR4_ORYBR; Uncharacterized protein
STRINGOB08G24950.11e-151(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.14e-31abscisic acid responsive elements-binding factor 2