PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G21740.1
Common NameLOC102711008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 345aa    MW: 38237.6 Da    PI: 4.2929
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G21740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26088.77.5e-2818318100
        DUF260  18 lapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                   +apyfpa+q+++f n+h+lFG+sn+lk+l++l++e  +dam++l+y+Ae+ra+dPv G+++vi +l++ql+ + ael+++ ++
  OB08G21740.1   1 MAPYFPADQQRRFLNAHRLFGVSNILKTLRHLKPELCDDAMRTLIYQAEMRAHDPVGGCCRVIADLERQLDAETAELNTVLHH 83 
                   59***************************************************************************998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.143184IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-25180IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MAPYFPADQQ RRFLNAHRLF GVSNILKTLR HLKPELCDDA MRTLIYQAEM RAHDPVGGCC  60
RVIADLERQL DAETAELNTV LHHLALCRQA AATGASASVA AIMPAGMLDD PCADLDVTSS  120
NQPLLLSAEQ EVVDALYANQ EPDATILHGD DGHHNQNGSQ HEQHHGQQQR LYDYFYYDST  180
TGDDVSSKPN LDINVDGMQH FDFDTGYDVE HKLELTSDQM PVVVHEPNQI HHKEFETKAA  240
PSFVDALDMR QEMVDVNTEI EVKEIVDMNA DLDVKEMVDM NVKTTMVDVN ADIDVVKTVV  300
DVNDDIGVKE ELQEVGNGKI VDAGKATQMA ESSSNCRLGL GFSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-1519028115LOB family transfactor Ramosa2.1
5ly0_B7e-1519028115LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB08G21740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695812.10.0PREDICTED: uncharacterized protein LOC102711008
TrEMBLJ3MSU40.0J3MSU4_ORYBR; Uncharacterized protein
STRINGOB08G21740.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-23LOB domain-containing protein 22