PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G20490.1
Common NameLOC102723076
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 182aa    MW: 20122.4 Da    PI: 9.8305
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G20490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.55.1e-173292363
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                  elkr rrk++NRe+A+rsR+RK++ ++ L   v +L+aeN++L  +l++ ++ +a+ ++++
  OB08G20490.1 32 ELKRKRRKESNRESAKRSRLRKQQHLDDLNSQVNQLKAENQQLGATLSMVTQSYAAAEAQN 92
                  89**************************************************999887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.5E-132684No hitNo description
SMARTSM003384.1E-183094IPR004827Basic-leucine zipper domain
PfamPF001701.1E-133186IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.4843295IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.19E-123386No hitNo description
CDDcd147028.07E-203586No hitNo description
PROSITE patternPS0003603752IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MTLSGGATSG SSGGTHRGSW SEGDIQLQAQ MELKRKRRKE SNRESAKRSR LRKQQHLDDL  60
NSQVNQLKAE NQQLGATLSM VTQSYAAAEA QNSVLRTQRT ELDSRLRALR EIVFYLNTPT  120
QLLPAAYPST TMTAAAAAAA SGHYYDYYDA ASANPWSSSG MQMMQQQQQP MDQFLLPVLG  180
SF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13338KRKRRK
23439RKRRKE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660081.11e-132PREDICTED: ocs element-binding factor 1-like
TrEMBLJ3MSH01e-132J3MSH0_ORYBR; Uncharacterized protein
STRINGOB08G20490.11e-131(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.13e-16basic leucine-zipper 44