PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G17980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 586aa    MW: 63671.8 Da    PI: 5.4085
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G17980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.48.3e-30263319259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    Dg+nWrKYGqK+vk+se++rsYYrCt ++C +kkkve++  d++vvei+Y+g+Hnhe
  OB08G17980.1 263 GDGFNWRKYGQKQVKSSENSRSYYRCTNSSCLAKKKVEHCP-DGRVVEIIYRGTHNHE 319
                   6****************************************.***************8 PP

2WRKY100.41.1e-31431488259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   +Dgy+WrKYGqK vkg+++prsYYrCt+ gCpv+k+ve++ +d + +++tYeg+Hnh+
  OB08G17980.1 431 SDGYRWRKYGQKIVKGNPNPRSYYRCTHDGCPVRKHVEKAPDDDNNIVVTYEGKHNHD 488
                   7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-26254321IPR003657WRKY domain
SuperFamilySSF1182901.44E-23256321IPR003657WRKY domain
PROSITE profilePS5081121.746257321IPR003657WRKY domain
SMARTSM007744.2E-32262320IPR003657WRKY domain
PfamPF031062.1E-22264319IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.9E-31424490IPR003657WRKY domain
SuperFamilySSF1182901.83E-27425490IPR003657WRKY domain
PROSITE profilePS5081132.799425490IPR003657WRKY domain
SMARTSM007742.0E-36430489IPR003657WRKY domain
PfamPF031064.5E-26432488IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MAGGDPAAAP EVEPPAAADV AGEHPPPEPP GAKPGEGKGK EVEVGRVKEK EGVEGKGMEE  60
EEVEVERVKE TETETEKAEA EQKETEGKAK EVQCKDSVEE GEGGKEKEGK EMEAKVKEEQ  120
GAESMEVDGG KEEKEKEKEK QKSMEVETKR RPAGVGGETP ILAVPMVAVP CFLASPAFAG  180
HFSMSHQAAL ASVTAQAQIQ LQSPTTSSYS EGLPSPFPIT PKAVMPLQQA PSGTAGSVYR  240
PVLEKSASFQ SRPQHHVSVN MVGDGFNWRK YGQKQVKSSE NSRSYYRCTN SSCLAKKKVE  300
HCPDGRVVEI IYRGTHNHEP PQKTRFLKER VAHITGSSGD DETLRLVNTE IIDSRSPGCK  360
LEPGAVPEAS EQQLFCSSDC EGDAGNKSED DHTSTDPQPK RRIIETSTPP LTPVLRTVRE  420
QKIIVQAGKT SDGYRWRKYG QKIVKGNPNP RSYYRCTHDG CPVRKHVEKA PDDDNNIVVT  480
YEGKHNHDQP FRNSTESRDG PVPPMVITAE TTSEQPSTMT SASDQKPTIS MPKDGGNEPA  540
KDKTSEPGGE KAVESAQTLL SIKTNPDDMK STLLKDTSAV VPVQNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-254324901977Probable WRKY transcription factor 4
2lex_A3e-254324901977Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB08G17980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2981860.0DQ298186.1 Oryza sativa (japonica cultivar-group) WRKY transcription factor 82 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695556.10.0PREDICTED: probable WRKY transcription factor 32
TrEMBLJ3MRR90.0J3MRR9_ORYBR; Uncharacterized protein
STRINGOB08G17980.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58203455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.15e-65WRKY DNA-binding protein 4