PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G31840.1
Common NameLOC102709015
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 226aa    MW: 25158.2 Da    PI: 7.9695
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G31840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.9e-102168552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52
                  kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  OB07G31840.1 21 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 68
                  9****************************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-141781IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5991982IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.5E-112172No hitNo description
PfamPF001705.7E-92165IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-102175No hitNo description
CDDcd147031.07E-192271No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEAKKAMSSE QLAELAAIDP KRAKRILANR QSAARSKERK ARYITELERK VQTLQTEATT  60
LSAQLTLFQR DTTGLSAENA ELKIRLQAME QQAQLRDALN DALKQEVERL KIATGEMTKS  120
NEAYNTGMQQ VPYNSSFFQL SEQHTVQHHS GVQQLQHQFQ QPHPSVPSHQ MLSHPNSLSD  180
MMQQDSLGRL QGLDIGKGQV AVKSEAEVIV KSEGSSISAG ESNNTF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1025620.0AK102562.1 Oryza sativa Japonica Group cDNA clone:J033097I23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658967.21e-165PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-113RF2B_ORYSJ; Transcription factor RF2b
TrEMBLJ3MP521e-165J3MP52_ORYBR; Uncharacterized protein
STRINGOB07G31840.11e-165(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.12e-72basic leucine-zipper 52