PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G26540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 366aa    MW: 40688.2 Da    PI: 6.2456
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G26540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY93.71.4e-29104160259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   dDgy+WrKYGqK vkg e+p+sYY+Ct+ +C v+k ve+sa d+++v+i+Y+g+H+he
  OB07G26540.1 104 DDGYSWRKYGQKAVKGGEYPKSYYKCTHLNCLVRKTVEHSA-DGRIVQIIYRGQHTHE 160
                   8****************************************.***************8 PP

2WRKY1053.9e-33272330159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYGqK+vkg++fprsYY+Ct+ gC vkk+vers e+p++v++tYeg+H h+
  OB07G26540.1 272 LDDGYRWRKYGQKVVKGNPFPRSYYKCTYLGCDVKKQVERSVEEPNAVITTYEGKHIHD 330
                   59*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-2798162IPR003657WRKY domain
SuperFamilySSF1182902.35E-24102162IPR003657WRKY domain
SMARTSM007743.7E-32103161IPR003657WRKY domain
PROSITE profilePS5081123.146104162IPR003657WRKY domain
PfamPF031066.0E-23104160IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-34259332IPR003657WRKY domain
SuperFamilySSF1182903.14E-29265332IPR003657WRKY domain
PROSITE profilePS5081134.532267332IPR003657WRKY domain
SMARTSM007745.2E-39272331IPR003657WRKY domain
PfamPF031061.3E-25273329IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MWRAIECSWD DEPGNFGVFP EQDLAPLTVT AHSKCTAVSQ AENQSFVPLA ASPLISQHVG  60
SSVNMTPFQE MLTLPSQISN VNTESSGVLQ GLPTSSIVLD RPDDDGYSWR KYGQKAVKGG  120
EYPKSYYKCT HLNCLVRKTV EHSADGRIVQ IIYRGQHTHE RPSKRRFKDC GSLSDDLDDF  180
SANTGSSART QTDYEDYCRK PIIPNGTTVG PLVKKMEDGD DQLSGSSDNQ EERDDEMRTA  240
DAPAGDSSAK ERNVPAPGQK IIVSTTSEVD LLDDGYRWRK YGQKVVKGNP FPRSYYKCTY  300
LGCDVKKQVE RSVEEPNAVI TTYEGKHIHD VPAARKKIHD VPNASVLQNT KSNTYCTEQA  360
FRTITC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-34104333878Probable WRKY transcription factor 4
2lex_A1e-34104333878Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB07G26540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418470.0AY341847.1 Oryza sativa (japonica cultivar-group) WRKY6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694711.10.0PREDICTED: probable WRKY transcription factor 3, partial
TrEMBLJ3MMM20.0J3MMM2_ORYBR; Uncharacterized protein
STRINGOB07G26540.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.12e-73WRKY DNA-binding protein 3