PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G25870.1
Common NameLOC102717728
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 545aa    MW: 60140 Da    PI: 6.3128
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G25870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS435.53.8e-1331755441373
          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                   l+elL++cA+av++++  +++ ++++l++++s +g+p++Rl ay++e+L arla+s+s++ykal+++e +   ss+ l+++++++e++P++kf+++ 
  OB07G25870.1 175 LKELLIACARAVEEKNSFAIDLMITELRKMVSVSGEPLERLGAYMVEGLVARLASSGSSIYKALKCKEPK---SSDLLSYMHFLYEACPYFKFGYMS 268
                   5799*****************************************************************9...9*********************** PP

          GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                   aN aI eav+ge+r+HiiDf isqG+QW++LlqaLa+Rp+gpp++RiTg++++ s   +   le +g+rL+++A  ++vpfef++l a + +++e  
  OB07G25870.1 269 ANGAIAEAVKGEDRIHIIDFHISQGAQWISLLQALAARPGGPPTVRITGIDDSVSAyaRGGGLELVGRRLSHIAGLCKVPFEFHPL-AISGSQVEEA 364
                   ****************************************************888899999************************6.778999**** PP

          GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                   +L v pgEa+aVn+ l+lh+++desvs++++rd++L++vk+lsP+v+++ve e+++n+++F +rf+e+l+yy+a+f+s++ +lpr+++eri++E+++
  OB07G25870.1 365 HLGVLPGEAVAVNFTLELHHVPDESVSTANHRDRLLRMVKGLSPRVLTLVEMESNTNTAPFTQRFAETLDYYTAIFESIDLTLPRDDRERINMEQHC 461
                   ************************************************************************************************* PP

          GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                   l+reivn+vaceg+er er e ++kW++rl++aG++p pls+ +++++++ll+ +++d y++ e++g+l+lgWk+rpLv+ SaW
  OB07G25870.1 462 LAREIVNLVACEGEERAERYEPFGKWKARLTMAGLRPSPLSSLVNATIRTLLQSYSDD-YKLAERDGALYLGWKNRPLVVSSAW 544
                   ********************************************************55.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.493149526IPR005202Transcription factor GRAS
PfamPF035141.3E-130175544IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MADTPTSRMI HPFSNISSQN LKQFQYSDNS QHPCHPYRGP SDTHVVPQHH YSLKSHSPDA  60
GCESQAAPNK YTLDSSEGAR CMRNDSPSSQ SFTTRSGSPL SQEDSHSDST DGSPVGASCV  120
TDDPTDLKQK LKDLEAVMLG PDSHIVNSLE NSVANQLSLE PEKWVHMMGI PRGNLKELLI  180
ACARAVEEKN SFAIDLMITE LRKMVSVSGE PLERLGAYMV EGLVARLASS GSSIYKALKC  240
KEPKSSDLLS YMHFLYEACP YFKFGYMSAN GAIAEAVKGE DRIHIIDFHI SQGAQWISLL  300
QALAARPGGP PTVRITGIDD SVSAYARGGG LELVGRRLSH IAGLCKVPFE FHPLAISGSQ  360
VEEAHLGVLP GEAVAVNFTL ELHHVPDESV STANHRDRLL RMVKGLSPRV LTLVEMESNT  420
NTAPFTQRFA ETLDYYTAIF ESIDLTLPRD DRERINMEQH CLAREIVNLV ACEGEERAER  480
YEPFGKWKAR LTMAGLRPSP LSSLVNATIR TLLQSYSDDY KLAERDGALY LGWKNRPLVV  540
SSAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-661795458375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2330320.0AC233032.1 Oryza minuta clone OM__Ba0042N21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657889.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 2
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLJ3MMF50.0J3MMF5_ORYBR; Uncharacterized protein
STRINGOB07G25870.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5