PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G13730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 794aa    MW: 85244.3 Da    PI: 7.01
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G13730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25.1e-16478516240
           TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  OB07G13730.1 478 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 516
                   589**********************************96 PP

2TCR50.93.2e-16563602140
           TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                   ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  OB07G13730.1 563 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCEGCKNTF 602
                   589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17477518IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.536478603IPR005172CRC domain
PfamPF036389.0E-12480515IPR005172CRC domain
SMARTSM011141.7E-17563604IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-12565601IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MQHRPPVVGT VSPFPALSRP PILTADSPLF SFIDSLSPIE PLKSAYSASS IQAYQSLNIT  60
SISSIFTSPH DNAQKESKLS KSSFAEFSES EVCAAEGDKN KPSKSSNAVR LFACASTLTQ  120
ATHRITSSVS EGTVVPPEGS NGLPQPGQFD AGSPDHNTTP CHGVRSDLKQ GKCRKLQPFQ  180
AAKNNTSEKR KCLFSTEVQL LDGCQPEKLN DEILGCEWDD LISATSGELI AYDEDHKGVQ  240
LAVSNAESCG FLLSKLTGDG DISDRTHPSS STQTYYRELL MEDDQPENAQ LIPDGEKNIS  300
SEEIQDNLYE ANGSIPTGYK VETQQQRGMR RRCLIFEATG YSNSIMQKES VMDLSASTCK  360
GKSPVENHPN PGKTPSPRVL RGIGLHLNAL ALTPKDKMVC QDPLASSLVP SSATQQEAHG  420
KLLSAGENFA HPGCELLELQ MDDDCSAGAF LGNDHNSSQS NSPQKKRRKA DNGDDGEACK  480
RCSCKKSKCL KLYCECFAAG VYCSEPCSCQ GCLNKPIHEE IVLSTRKQIE FRNPLAFAPK  540
VIRTSDAGQE TGEDPNNTPA SARHKRGCNC KKSSCLKKYC ECYQGGVGCS SNCRCEGCKN  600
TFGKRDAAVS TEAEEMKQGG EEAENCGKEK ENDLQKANVQ SEDHPILELV PITPPFDVSS  660
SLFKPPNFSS AKPPRPTKAR SAISSRPSSK SAQAAHSRKI SKAADSGLNE EMPDILKDDA  720
SPGNCVKTSS PNGKRVSPPH NALSVSPSRK GGRKLILKSI PSFPSLIGDT SSGSAMNSSD  780
RAFSTASPLA LGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1648260014120Protein lin-54 homolog
5fd3_B2e-1648260014120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1464468KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB07G13730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658970.0AK065897.1 Oryza sativa Japonica Group cDNA clone:J013048O08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658327.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLJ3MIZ10.0J3MIZ1_ORYBR; Uncharacterized protein
STRINGOB07G13730.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-89TESMIN/TSO1-like CXC 2