PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G12010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 719aa    MW: 79809.5 Da    PI: 10.1
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G12010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.72.4e-0793184146
                      TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqk 46 
                      +++W+  E ++l++++kq   +                                              +W++Ia++   gR++ +c srw++
     OB07G12010.1  93 KQPWSDAEKDKLAKGIKQQYQEalildsmnngsstgdfsavdmayaltntagnfemtpeslrsvlpliNWDKIAAMYLPGRSGAECESRWLN 184
                      799***************99999***************************************************99888***********98 PP

2Myb_DNA-binding292.5e-09193237246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v+q G+++W  Ia  +g++Rt+ qc  ++q 
     OB07G12010.1 193 NAWTAREEKRLLLTVQQQGMNNWINIAVALGTHRTPFQCLAHYQR 237
                      68*****************************************96 PP

3Myb_DNA-binding47.34.9e-15247290348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       W++eEd++l  av+ +G++ W ++++ m  gRt++qc +rw+k l
     OB07G12010.1 247 DWSKEEDLQLQAAVNTFGTN-WQLVSASMD-GRTGNQCSNRWRKTL 290
                      6*****************99.*********.************975 PP

4Myb_DNA-binding44.82.9e-14298343248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+ +Ed++l  avk++ + +W++Ia+ ++ gRt  qc +rw+++l
     OB07G12010.1 298 GRWSLDEDKRLMVAVKLFESASWNKIAQFIP-GRTQSQCNERWRNVL 343
                      8******************************.************986 PP

5Myb_DNA-binding27.57.5e-09350394247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHH.HHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIa.rtmgkgRtlkqcksrwqky 47 
                      g+W +eEd +l+  v ++G+  W +Ia ++++ +Rt+++c  rw+ +
     OB07G12010.1 350 GKWRPEEDSKLLASVDEFGPC-WCKIAgAKIP-HRTDNMCLRRWRRL 394
                      79*****************88.****945777.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.22688184IPR017877Myb-like domain
SMARTSM007171.0E-492188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-793125IPR009057Homeodomain-like
CDDcd001670.00136157184No hitNo description
Gene3DG3DSA:1.10.10.603.0E-7161206IPR009057Homeodomain-like
SuperFamilySSF466893.51E-5161196IPR009057Homeodomain-like
PROSITE profilePS500908.246187239IPR017877Myb-like domain
SuperFamilySSF466894.4E-22191286IPR009057Homeodomain-like
SMARTSM007172.9E-5191241IPR001005SANT/Myb domain
PfamPF002491.4E-6193237IPR001005SANT/Myb domain
CDDcd001671.87E-5194239No hitNo description
Gene3DG3DSA:1.10.10.602.5E-8207245IPR009057Homeodomain-like
PROSITE profilePS5129416.707240294IPR017930Myb domain
SMARTSM007174.7E-13244292IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-15246292IPR009057Homeodomain-like
PfamPF002492.2E-13247289IPR001005SANT/Myb domain
CDDcd001671.52E-10248290No hitNo description
PROSITE profilePS5009010.348292343IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.3E-16295343IPR009057Homeodomain-like
SuperFamilySSF466898.07E-24296391IPR009057Homeodomain-like
SMARTSM007176.4E-10296345IPR001005SANT/Myb domain
CDDcd001671.76E-9299343No hitNo description
PfamPF139211.9E-13300360No hitNo description
Gene3DG3DSA:1.10.10.604.2E-15344399IPR009057Homeodomain-like
PROSITE profilePS5129416.653344399IPR017930Myb domain
SMARTSM007177.6E-9348397IPR001005SANT/Myb domain
CDDcd001676.67E-9351394No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MITIEAKIEE NKDLRDRVKC LLDYQLSCRK AFGKILCQKE DPRVRLVSSR RPCAQSAKNK  60
DKKTPALFLG PADNPHVSKY KMALKQFPMS LQKQPWSDAE KDKLAKGIKQ QYQEALILDS  120
MNNGSSTGDF SAVDMAYALT NTAGNFEMTP ESLRSVLPLI NWDKIAAMYL PGRSGAECES  180
RWLNCDDPLI NHNAWTAREE KRLLLTVQQQ GMNNWINIAV ALGTHRTPFQ CLAHYQRSLN  240
HCILNKDWSK EEDLQLQAAV NTFGTNWQLV SASMDGRTGN QCSNRWRKTL NPERSRVGRW  300
SLDEDKRLMV AVKLFESASW NKIAQFIPGR TQSQCNERWR NVLDPDIDLG KWRPEEDSKL  360
LASVDEFGPC WCKIAGAKIP HRTDNMCLRR WRRLCKDKLP SIKAAHQIKK AIFQSNFVDR  420
ETERPAIGPS DLMPIVCSKV GGIGDSTVSA QARKPRKSSR MPCENNILPS DTLNSSASVN  480
LSLSESIDPE AVVNTTTSSS RRKSSRSKSQ FDENLAVSDD VNNSSNCSSG ARKRKRSVAG  540
NNQVAQKKIR GSNSGDNEAE TMGCSISVNN EVAEKRTAKK RTRKVSFSGK EGEPKKRMKG  600
SVSGVHEGAT KRMRGSISTG NYGVVMKSKR APSRKSAKEN SKADSMTEGS VDKYSTSTRL  660
ADCMPFTRIN GPSRVASHLC VSVGPLSNMV HSNGPSNDMS AIAISSGPDP TYVESSSIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-241644168159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-241644168159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654520.0AK065452.1 Oryza sativa Japonica Group cDNA clone:J013025M19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694522.10.0PREDICTED: uncharacterized protein LOC102706862, partial
TrEMBLJ3MIG90.0J3MIG9_ORYBR; Uncharacterized protein
STRINGOB07G12010.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-141myb domain protein 4r1