PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G35370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 468aa    MW: 50397.7 Da    PI: 9.0108
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G35370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.52.9e-08293337852
                   HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                   +r   NR A r++R++Kka ++ Lee+v  L a N++L k+l++ 
  OB06G35370.1 293 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQNH 337
                   55566**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR012172.7E-154157No hitNo description
PRINTSPR012172.7E-155875No hitNo description
PRINTSPR012172.7E-1576101No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-13282354No hitNo description
SMARTSM003381.5E-7284353IPR004827Basic-leucine zipper domain
PfamPF077169.9E-15287343IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.38E-7290337No hitNo description
CDDcd146862.42E-11298345No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MIGSIALRAW QRGYHFALRH DRFRVSSRRR TTPRHAAPRQ PTLPPPPPPP PPPPPPPPPP  60
PPPPPPPPPP PPPPPPPPPP PPPPPPPPPP PPPPPPPPPP PPPPPHNPPR RRRQRQRASL  120
LSSDLPPPRA ARFLSPVTPP SLPPSLSSRF VIRLVLANSE RDRNPQIDLP EFGAPCVILV  180
VFGDQVCAPL PAIRRRRAAM DDGDIDFSNP DTFLCPAAGA GADPDGSCSM DSYFDDILKD  240
TEHHACTHTH TCNPPVHDLS HTHTCVHVHT KIVSAPSDDA DSPTTADNNA SKKRPSGNRA  300
AVRKYREKKK AHTASLEEEV VHLRALNQQL MKKLQNHAAL EAEVSRLRCL LVDIRGRIEG  360
EIGAFPYQRP AKNIDLVSSV DQGSFLGGAQ VMNSCDFRCA DQMYCSPGMQ VRTMAEDGAM  420
SGQVLGQGAC DIASIQCTGS AKSGSTKLPV CGAMGTMPVG SLPNSEKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8322750.0CT832275.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA007M11, full insert sequence.
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankAC0917740.0AC091774.7 Oryza sativa chromosome 6 BAC OJ1540_H01 genomic sequence, complete sequence.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0037690.0AP003769.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0541C02.
GenBankAP0036140.0AP003614.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0481E08.
GenBankAK1039680.0AK103968.1 Oryza sativa Japonica Group cDNA clone:001-016-A09, full insert sequence.
GenBankAK0716390.0AK071639.1 Oryza sativa Japonica Group cDNA clone:J023099K10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656494.10.0PREDICTED: uncharacterized protein LOC102721653
TrEMBLJ3MHP30.0J3MHP3_ORYBR; Uncharacterized protein
STRINGOB06G35370.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.15e-62bZIP family protein