PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G34330.1
Common NameLOC102709851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 471aa    MW: 50801.6 Da    PI: 9.255
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G34330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.7e-41181257278
                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   CqvegC++dls+a+eyhr+hkvCe+hskap+v+vsgle+rfCqqCsrfh lsefD++k+sCrrrL++hn+rrrk+q+
  OB06G34330.1 181 CQVEGCKVDLSTAREYHRKHKVCEAHSKAPKVTVSGLERRFCQQCSRFHGLSEFDQKKKSCRRRLSDHNARRRKPQQ 257
                   **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.9E-33173242IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.359178255IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38180260IPR004333Transcription factor, SBP-box
PfamPF031102.0E-31181254IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MASFGMNNWN QKSPMFWDWE NPALFGPNSM ENSKIVPHPE SRGVVVGAAN HGSTNSSSGG  60
MFTSSSELAN GSSKSSLSAS FDSSSKLGNS LEFRFASVKG HGKNTSKDGE AARVEDSGTS  120
PAVAGSHGEP IIGLKLGKRT YFENVCGGQN VKSSAASGAT CPSTVAKKAK ASQQNTQSSY  180
CQVEGCKVDL STAREYHRKH KVCEAHSKAP KVTVSGLERR FCQQCSRFHG LSEFDQKKKS  240
CRRRLSDHNA RRRKPQQETI SFGSSRLATM FYDARQQTDI YFGQSPFGQV RSNAISSCDN  300
LGGFKFTEAK LPWMKPMKTV GLEELHFSTL QMPNNVVAQT VHHHDFDGLI PFKGNTTKVL  360
NKGVETSAVV SSNSNGAPDL RRALSLLSSD FWGPADVQPS SQVHPGGVMP PLATVAAPTN  420
PANVMHHALH HPSPGGFWQD DEPPPPLDHA AQVQAFMHLG SSSDSGYGHL H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-281812541184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1236253KKKSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1021360.0AK102136.1 Oryza sativa Japonica Group cDNA clone:J033085H14, full insert sequence.
GenBankAK0731790.0AK073179.1 Oryza sativa Japonica Group cDNA clone:J033004F21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656454.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694397.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694398.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694399.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694400.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694401.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694402.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694403.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694404.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015694405.10.0PREDICTED: squamosa promoter-binding-like protein 12
SwissprotA2YGR50.0SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLJ3MHD90.0J3MHD9_ORYBR; Uncharacterized protein
STRINGOB06G34330.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.38e-52squamosa promoter binding protein-like 2