PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G17750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 800aa    MW: 90446.9 Da    PI: 6.6045
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G17750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.21.4e-27677727252
        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    k++++e +s+yF++pi++AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  OB06G17750.1 677 DKSLTFELVSQYFYMPITQAARELNVGLTLLKKKCRELGIPRWPHRKMKSL 727
                   589**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513757.991538IPR002885Pentatricopeptide repeat
PfamPF128547.9E-103866IPR002885Pentatricopeptide repeat
PROSITE profilePS5137512.6493973IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.0E-54169IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.1E-473100IPR002885Pentatricopeptide repeat
PfamPF015359.5E-47399IPR002885Pentatricopeptide repeat
PROSITE profilePS513755.71174100IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.662101136IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.1E-8117230IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513758.835137171IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007567.0E-5140162IPR002885Pentatricopeptide repeat
PfamPF015352.1E-4140162IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.786182216IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007568.4E-5184214IPR002885Pentatricopeptide repeat
PfamPF015352.6E-4184213IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007565.3E-4215240IPR002885Pentatricopeptide repeat
PfamPF015351.0E-6215241IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.566217243IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.846244274IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.9E-4246275IPR002885Pentatricopeptide repeat
PfamPF015353.2E-4246275IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.323275309IPR002885Pentatricopeptide repeat
PfamPF130417.8E-11276322IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007566.4E-7277310IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.1E-8278305IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513755.393310340IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.1E-8342403IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513758.407344374IPR002885Pentatricopeptide repeat
PfamPF015350.0097349374IPR002885Pentatricopeptide repeat
PfamPF130419.5E-12375423IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.937376410IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007562.7E-6378411IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.454411441IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007560.0014413445IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.059447477IPR002885Pentatricopeptide repeat
PfamPF015350.46451475IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.1E-8474533IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513756.84513547IPR002885Pentatricopeptide repeat
PROSITE profilePS5151918.906663747IPR003035RWP-RK domain
PfamPF020423.0E-21679727IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016554Biological Processcytidine to uridine editing
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MPVRDAVSWN TLLVAYSSSA HPDHLAAARR LFDEMPQRDV VTWNTLLGAY ARRGLMDEAQ  60
RLFDEMPQRN TASWNTMVTG FFAAGQVRKA LDAFDVMPAK DSASLSTMVS GFTKNGLLCE  120
AEELLTKRLR VTDMDKAVDA YNTLIAAYGQ AGRVSDARRL FDIIPKGQHQ CNMLKRNVFE  180
RNVVSWNSMM ACYIKVGDVC SARALFDEMT DKDLVSWNTM ISGYSQVADM KEAEKLFWEM  240
PDPDSVSWNL IIRGFMQKGE VVHARGFFDG MPERGTISWN TMISGYEKNG DYVSSVKLFS  300
EMLEAGKIPD RHTFSSVLAA CASLPMLHLG AQIHQLVEKS FVPDTAISNA LITMYSRCGA  360
LTDAEAIFKQ MHTKKDLVSW NALIGGYEHH GHATKALKLF KEMRSAKVMP THITFISLLN  420
ACVNAGLVSE GRMVFDTMVH EYGIVARIEH YAALVNLIGR HGQLDDALEV INSMPMAPDR  480
SVWGAFLGAC TAKKNEPLAQ MAAKQLSKIN PDSSAPYVLI HNLYAYEGRW GSAAVVREEM  540
ERQGVYKQPG LAMAQPVNLE TSQLTQVSFF ERPVNWWPYC TSLWPDSYLL EEEALFSSLS  600
FQSFHPQPVC TTVMESNGLQ GELDVIFDDD VLMYWDEMEQ SENKGQEREK GLPLLCYGNE  660
KGADSKIMRV DDVRSEDKSL TFELVSQYFY MPITQAAREL NVGLTLLKKK CRELGIPRWP  720
HRKMKSLQTL IKNVQVLQEA SKANNEEQLR MLVEMLQEER KLLEQKPYVQ LEEKTKRLRQ  780
ACFKANYKKR RLLALEAGEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5i9f_A2e-5455452429pentatricopeptide repeat protein dPPR-U10
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB06G17750.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0035090.0AP003509.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0525F01.
GenBankAP0035690.0AP003569.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0425F05.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025882382.10.0pentatricopeptide repeat-containing protein At1g62260, mitochondrial isoform X1
TrEMBLJ3MCN10.0J3MCN1_ORYBR; Uncharacterized protein
STRINGOB06G17750.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108991212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-43RWP-RK domain-containing protein