PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G15720.1
Common NameLOC102706854
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 1051aa    MW: 116178 Da    PI: 6.5421
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G15720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.36e-23127228199
                   EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                   f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   ++++ 
  OB06G15720.1 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELSAKDLHDISWKFRHIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFI--RDEKS 219
                   99*****************************96555544..8************************************************..45677 PP

                   ..EEEEE-S CS
            B3  91 elvvkvfrk 99 
                   +l+++++r+
  OB06G15720.1 220 QLLLGIRRA 228
                   789999997 PP

2Auxin_resp119.52.7e-39253335183
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                   aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dld+ rW+nS+Wr+L+
  OB06G15720.1 253 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDQARWKNSHWRNLQ 335
                   79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.49E-44117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.1E-40119242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.91E-19126227No hitNo description
SMARTSM010191.7E-22127229IPR003340B3 DNA binding domain
PROSITE profilePS5086312.111127229IPR003340B3 DNA binding domain
PfamPF023626.8E-21127228IPR003340B3 DNA binding domain
PfamPF065071.5E-34253335IPR010525Auxin response factor
PfamPF023098.6E-99321021IPR033389AUX/IAA domain
PROSITE profilePS5174524.4739351019IPR000270PB1 domain
SuperFamilySSF542773.83E-79531014No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1051 aa     Download sequence    Send to blast
MKDQGSSGVS PGPAEGEKKA INSELWHACA GPLVSLPPVG SLVVYFPQGH SEQVAASMNK  60
ELDNIPGYPS LPSKLICKLL SLTLHADSET DEVYAQMTLQ PVNKYERDAM LASELGLKQN  120
KQPAEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDFTM QPPAQELSAK DLHDISWKFR  180
HIYRGQPKRH LLTTGWSVFV STKRLLAGDS VLFIRDEKSQ LLLGIRRATR PQPALSSSVL  240
SSDSMHIGIL AAAAHAAANS SPFTIFYNPR ASPSEFVIPL AKYNKALYTQ VSLGMRFRML  300
FETEDSGVRR YMGTITGIGD LDQARWKNSH WRNLQVGWDE STASERRTRV SIWEIEPVAT  360
PFYICPPPFF RPKLPKQPGM PDDENEVESA FKRAMPWLAD DFALKDVQSA LLPGLSLVQW  420
MAMQQNPQML TAASPTVQSP YLTPNVLAMQ DVMGNSNEDP TKRLNAQSQN IVLPNLQVGS  480
KVDHPVMSQH QQQPHQLSQQ QVQPSQQSSV ILQQHQAQLL QQNTIQLQQH QEHLQRQQSQ  540
PAQQFKAAAS LHSVEQHKLK EQTSGGQVAS QAQLLNQIFP PSSSQLQQLG LPKSPTQRQG  600
LTGLPSSGSL QQSTLTQTSQ VQQATEYQQA LLQSQQQQLQ QLSQPEVQLQ LLQKIQQQNM  660
LSQLNPQHQS QLIQQLSQKS QEILQQQILQ HQFGGSDAMG QLKQSPSQQA PLNHITGSLT  720
PQQLVRSHSA LAESGDPSSS TAPSASRISP LNSLSRAHQG SRNLTDMVAT PQIDNLFQEI  780
QSKPDNRLKN DIQSKEPVSV PSRHPVSDQL DASSATSFCL DESPREGFSF PPVCLDNNVQ  840
VDPRDNFLIA ENVDALMPDA LLSRGMASGK GMCTLTSGQR DHRDVENELS SAAFSSQSFG  900
VPDMSFKPGC SSDVAVTDAG LPSQGLWNNQ TQRMRTFTKV QKRGSVGRSI DITRYRDYDE  960
LRHDLACMFG IQGQLEDPYR MDWKLVYVDH ENDILLVGDD PWEEFVGCVK SIKILSAAEV  1020
QQMSLDGDLG GVPSQTQACS ASDDANAWRG S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1631735647388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB06G15720.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1033270.0AK103327.1 Oryza sativa Japonica Group cDNA clone:J033125L14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656735.10.0PREDICTED: auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLJ3MC280.0J3MC28_ORYBR; Auxin response factor
STRINGOB06G15720.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]