PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G11610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 480aa    MW: 51574.4 Da    PI: 6.3299
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G11610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1541.3e-472053451138
          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkfs 94 
                   lv++L++cA+ ++++++e+a+ +Larl e+asp+g +pm+R+aayfteALa r++++++ ++++ pp++ +++    ++ ++al++++ v+Pi++f 
  OB06G11610.1 205 LVRALIACADSITTRNHEAANYYLARLGEMASPAGpTPMHRVAAYFTEALALRVVHQWPLMFDISPPRDLTDDAfgGDDDAMALRVLNAVTPIPRFL 301
                   6899******************************************************************9988999******************** PP

          GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg 138
                   h+t N+ +l+a+eg+ervH+iDfdi+qGlQWp Llq+La+R++ 
  OB06G11610.1 302 HFTLNERLLRAFEGHERVHVIDFDIKQGLQWPGLLQSLATRASR 345
                   *****************************************865 PP

2GRAS71.21.9e-22357453282374
          GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaG.Fkpvplsekaakqaklllrkvk.sdgyrveee..sgslvlgWkdrpLvsvSaWr 374
                   r    re+++rei+n+va eg+er+erhe+++ Wr+ +e+ G Fk++ +++++a+q +++ r+++  d y+v+ +   + l+l W+d+pL++v+aW+
  OB06G11610.1 357 RGRRCREMFAREIRNAVAFEGTERFERHESFAGWRRLMEDGGvFKNAGIGDREAMQGRMIARMFGgPDKYSVQAQgdGEGLTLRWMDQPLYTVTAWT 453
                   44445678********************************9999*********************9899***9654367788**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098524.928179480IPR005202Transcription factor GRAS
PfamPF035144.6E-45205345IPR005202Transcription factor GRAS
PfamPF035146.8E-20357453IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MLAGCSFSSR HQMSTAQRFD ILPCGFSKRG NRGDGAAPRV AGDARSGTTC SFRTHPAPPV  60
TQAGSWGAQA RAVKRSHDDD AVEEYGPIVR AKRTRMGGDG DEVWFHQSIA GTMQATAAGE  120
GEEAEEEKVF LVPSAAAFPH GMAAAGPSLA AAKKEEYSKS PSDSSSSSSG TDGGSSAMLP  180
PPPPEFDARN GVPAPGQAEQ EALELVRALI ACADSITTRN HEAANYYLAR LGEMASPAGP  240
TPMHRVAAYF TEALALRVVH QWPLMFDISP PRDLTDDAFG GDDDAMALRV LNAVTPIPRF  300
LHFTLNERLL RAFEGHERVH VIDFDIKQGL QWPGLLQSLA TRASRRRTCG SPESASRGRR  360
CREMFAREIR NAVAFEGTER FERHESFAGW RRLMEDGGVF KNAGIGDREA MQGRMIARMF  420
GGPDKYSVQA QGDGEGLTLR WMDQPLYTVT AWTPAGDGDG DGAGGSTVSA STTASHSQQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-132053524148GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0028380.0AP002838.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0038F22.
GenBankAP0011680.0AP001168.1 Oryza sativa Japonica Group genomic DNA, chromosome 6, clone:P0425F02.
GenBankAK1064490.0AK106449.1 Oryza sativa Japonica Group cDNA clone:002-103-E10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642886.11e-180PREDICTED: scarecrow-like protein 28
RefseqXP_015642887.11e-180PREDICTED: scarecrow-like protein 28
TrEMBLJ3MAW70.0J3MAW7_ORYBR; Uncharacterized protein
STRINGOB06G11610.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.13e-48GRAS family protein