PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G33500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 105aa    MW: 12259.1 Da    PI: 10.2041
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G33500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY56.94.1e-184422159
                  -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                   rsYYrCt+++Cpvkk+vers +d  vv++tYeg+H+h+
  OB05G33500.1  4 CRSYYRCTTQKCPVKKRVERSYQDAAVVITTYEGKHTHQ 42
                  69************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007743.6E-9243IPR003657WRKY domain
SuperFamilySSF1182901.44E-14444IPR003657WRKY domain
PfamPF031061.4E-12442IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.9E-17444IPR003657WRKY domain
PROSITE profilePS5081118.085544IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MDGCRSYYRC TTQKCPVKKR VERSYQDAAV VITTYEGKHT HQIPATLRGT AHLLXXXXXX  60
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXGRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G33500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1209865e-70AC120986.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1781_H11, complete sequence.
GenBankAP0149615e-70AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126135e-70CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3M9S61e-30J3M9S6_ORYBR; Uncharacterized protein
STRINGOB05G33500.12e-31(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-23WRKY DNA-binding protein 71