PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G33320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 657aa    MW: 72592.2 Da    PI: 7.0402
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G33320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.21.8e-2489190199
                   EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                   f+k+lt sd++++g +++p++ ae++       ++ ++  ++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + +++
  OB05G33320.1  89 FCKTLTASDTSTHGGFSVPRRAAEDCfppldysQQRPA--QELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDG 181
                   99****************************97544444..48************************************************..34899 PP

                   ..EEEEE-S CS
            B3  91 elvvkvfrk 99 
                   el+++v+r+
  OB05G33320.1 182 ELRLGVRRA 190
                   99***9996 PP

2Auxin_resp107.51.4e-35215295182
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                   +aha++t+svF+++YnPr s+seF+v+++k++k+l++++svG Rfk+++e+ed+ err++G+++g  d+dp  W++SkW++L
  OB05G33320.1 215 VAHAVATESVFNIYYNPRLSQSEFIVPYWKFMKSLSQPFSVGLRFKVRYESEDATERRYTGIITGSGDTDP-IWHGSKWKCL 295
                   79*********************************************************************.8********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.5E-4180192IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.05E-4383205IPR015300DNA-binding pseudobarrel domain
CDDcd100171.56E-2287189No hitNo description
SMARTSM010197.6E-2389191IPR003340B3 DNA binding domain
PROSITE profilePS5086313.42289191IPR003340B3 DNA binding domain
PfamPF023622.0E-2289190IPR003340B3 DNA binding domain
PfamPF065076.8E-30215295IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MTGIDLNTVE EDEEEAAAVA EEVVVAAAVN CSQSAAPART SAADPATDEV YAELSLVPEK  60
EEVVRRTDDA NAEEGDAMKQ RFARMPHMFC KTLTASDTST HGGFSVPRRA AEDCFPPLDY  120
SQQRPAQELV AKDLHGTEWR FRHIYRGQPR RHLLTTGWSA FVNKKKLVSG DAVLFLRGDD  180
GELRLGVRRA AQLKNGSAFP ALYNQCSNLG TLANVAHAVA TESVFNIYYN PRLSQSEFIV  240
PYWKFMKSLS QPFSVGLRFK VRYESEDATE RRYTGIITGS GDTDPIWHGS KWKCLLVRWD  300
DDTEFRRPNK VSPWEIELTS SVSGSHLSTP HSKRLKPCLP HVNPEYMVPH GGGCPDFAES  360
TQFHKVLQGQ ELLGFKSHGA TAAATSQPCE ARHLQYINER SCSNDASNNI LGVPRLGDRT  420
SLGNPGFPYH CSGFGESQRL QKVLQGQEVF RPYRGTLVDV SMGSNGFHQQ DGPRTPGVVN  480
KWHAQLHGRA AFHGPPALPS QSSSPPSVLM FQQANSKMPR FEFGHGQLDK HENDRRVRFG  540
PSEGIERTEQ RISLQPNPAS GEVSDGQTIV EKSHSPGRLG KDGTDNKALG TNSCKIFGIS  600
LTEKVPAREE LDHDDANYSL QSLKQVPKSL GNSCATVHEQ RPVVGRVIDI STMDMMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A7e-984332584361Auxin response factor 1
4ldw_A7e-984332584361Auxin response factor 1
4ldw_B7e-984332584361Auxin response factor 1
4ldx_A9e-984332584361Auxin response factor 1
4ldx_B9e-984332584361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G33320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712900.0AB071290.1 Oryza sativa OsETTIN1 mRNA for Arabidopsis ETTIN-like protein 1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693178.10.0PREDICTED: auxin response factor 15 isoform X2
SwissprotQ8S9850.0ARFO_ORYSJ; Auxin response factor 15
TrEMBLJ3M9Q80.0J3M9Q8_ORYBR; Auxin response factor
STRINGOB05G33320.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-134ARF family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  3. Khanday I,Yadav SR,Vijayraghavan U
    Rice LHS1/OsMADS1 controls floret meristem specification by coordinated regulation of transcription factors and hormone signaling pathways.
    Plant Physiol., 2013. 161(4): p. 1970-83
    [PMID:23449645]