PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G31630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 2423aa    MW: 275550 Da    PI: 7.4498
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G31630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.62.9e-29133191159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++d+++v++tYeg+Hnh 
  OB05G31630.1 133 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDKDDQSYVVTTYEGTHNHV 191
                   59********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-31119193IPR003657WRKY domain
SuperFamilySSF1182904.05E-26125193IPR003657WRKY domain
PROSITE profilePS5081131.181128193IPR003657WRKY domain
SMARTSM007745.7E-34133192IPR003657WRKY domain
PfamPF031064.2E-23134190IPR003657WRKY domain
PfamPF027362.2E-7282318IPR004009Myosin, N-terminal, SH3-like
SuperFamilySSF525401.87E-2783051055IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0024203281004IPR001609Myosin head, motor domain
PROSITE profilePS51456268.4283341003IPR001609Myosin head, motor domain
PfamPF000635.7E-255337991IPR001609Myosin head, motor domain
CDDcd013840348991No hitNo description
PRINTSPR001934.8E-60364383IPR001609Myosin head, motor domain
Gene3DG3DSA:3.40.50.3003.4E-4413433IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR001934.8E-60421446IPR001609Myosin head, motor domain
Gene3DG3DSA:3.40.50.3001.6E-4434463IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR001934.8E-60468495IPR001609Myosin head, motor domain
PRINTSPR001934.8E-60701729IPR001609Myosin head, motor domain
Gene3DG3DSA:3.40.50.3003.4E-4735785IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR001934.8E-60754782IPR001609Myosin head, motor domain
SMARTSM000152810051027IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.45510061035IPR000048IQ motif, EF-hand binding site
SMARTSM000158.110531075IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500966.55910541083IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525401.94E-810541153IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000159311011123IPR000048IQ motif, EF-hand binding site
SMARTSM0001513011241146IPR000048IQ motif, EF-hand binding site
Gene3DG3DSA:3.40.50.3001.6E-411571235IPR027417P-loop containing nucleoside triphosphate hydrolase
CDDcd154752.48E-18020232389No hitNo description
PROSITE profilePS5112648.20320602366IPR002710Dilute domain
SMARTSM011325.6E-3522412348IPR002710Dilute domain
PfamPF018431.5E-2222422345IPR002710Dilute domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016459Cellular Componentmyosin complex
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003774Molecular Functionmotor activity
GO:0003779Molecular Functionactin binding
GO:0005524Molecular FunctionATP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2423 aa     Download sequence    Send to blast
MAAVGAHALL YHHPVVSGDG HSMSSYFSHG GSSTSSPASS FSAALGAATT PPLADPSGAA  60
QFDISEFFFD DAPPAPAAVF NGPPAAVLPD GAAASAAAAH ATRSSSEVVP APAVERPRTE  120
RIAFRTKSEI EILDDGYKWR KYGKKSVKNS PNPRNYYRCS TEGCSVKKRV ERDKDDQSYV  180
VTTYEGTHNH VSPSTVYYAS QDAASGRFFV AGTQPPAVKY KLISTYKFKL SFDGIAEKPR  240
VCCSSEKLVK EGFEFKHVNL EEIFDDLVEY GKAAATLKIV LGSHIWLEDK DLAWIDGEVF  300
RIEGQKAHIR TTNGKMVVAS ISDIHPKDTE VPSDGIDDMI RLSYLHEPGV LNNLSVRYAK  360
NIIYTYTGNI LIAINPFQRL PHLAEPHTMA KYKGANFGEL DPHVFAIADV SYRQMMNERK  420
SNSILVSGES GAGKTETTKM LMRYLAFLGG RSRTGARTVE QQVLESNPVL EAFGNAKTVR  480
NNNSSRFGKF VEIQFDKSGK ISGAAIRTYL LERSRVCQIN SPERNYHCFY FLCAAPSEDI  540
RKYNLGEPSS FHYLNQSTCI KVDGISDTEE YLSTRSAMNT VGITEQEQEA IFRVVAAVLH  600
LGNINFVKGR EVDSSVIKDE KARFHLNAAA ELLMCDRGKL ENAMIKRKIN TPEGVITTTV  660
DPNSATVSRD GLAKQIYSRL FDWLVNRLNA SIGQDENSEH LIGVLDIYGF ESFKNNSFEQ  720
LCINFTNEKL QQHFNQNVFK MEQEEYNREQ IDWSYIEFVD NQDVLDLIEK KPGGIVALLD  780
EACMFPKCTH ESFSQKLYEK FRNHKRFSKP KLSRTAFTIQ HYAGEVTYQS DHFLDKNRDY  840
VVVEHQELLN ASKCSFVSGL FPSVQEENTK SSKSSIATRF KGQLHELMET LSSTEPHYIR  900
CIKPNNLLKP ATFENSNVLH QLRCSGVLEA IRISCAGYPT RKLFHDFLQR FRVLAPEFFK  960
ERNDEKVICQ KILDKIGLQG YQIGRTKVFL RAGQMAELDA RRTEVHTRAA RAVQSRFRTH  1020
VAREQFLILR NTSISFQSLV RAILACKLHL FLRKQAAALK IQKNARCYFA SKSFSELRSS  1080
AITLQTGLRT FGAYNEYIRR KKNKASTDIQ TQWRCHRDNS NYLKLKTSVL VYQCAWRRQV  1140
AKGKLRKLKM AARDTEALKV EKEKLEEHVE ELSSRLGLEK KLRTDLENSR AAEISKLQAT  1200
LCEMERRVEE ARASQERESA KKVVEEALVL EREKIALLNK EVEELKVLLL KEQEEKNAVK  1260
SASFIAQERS NDLTKKVEVA DENFKHLKDT LKSFEESTKG LEISLMMERQ QNEANRRQIG  1320
EAQQRVEELL RQVADANGKS TSLQTTVRRL EQSLLENETT WLTERQESEA TNKLLVEAHG  1380
KNEELLNKIE VSESNIAKFR DNIQRFEETA TTLETSLLAE KQHSAAIMSQ LAEMKQGNEE  1440
LQKKLADANR TNNLLQDSLK RFEENATTRD ALYVAERQEH DQTKQSLSKS QERNWELLRK  1500
VDEAEKSINR LLENAQRLEK HATSRESLLL KTKQSHDSTT KALIEAERRN QELTKSLEDL  1560
ERKTNLLEDS VNRLKECTAE KDSLLAIHRQ ENDATKDELT NAHRKITELV NEFQQLQEIR  1620
RHLEDNIKRL EEDAITREAL LLSEKQTHEV AKQTLSETQL RNGELINKIQ DCDKHTLQLQ  1680
LTVERLQENA STMEAVLLRE REQSNATMKA HSESQERNSQ LLKKFEDVDK KIGFLQGTIQ  1740
RLGEQTTKDT LLLSERQEKD ELKKALTETE YRNEGLVIKI EEANKRVEHL QDTVTVLKEN  1800
IVAQAANMEA ERQENDRTRK SLVEAQERNE GLFKKVRDSE YRAQQLQDTV QKLKQEGDAV  1860
KKALAESHGR IEDLIRRNED LLNRNDDLIK KIEDSGQVIS ELQATLGRIE GKTTNLDAEN  1920
HILRQQANAT PPSTAKSQAA FSKISMIHRS PENGHILNGN VAYAEKFSTG PAETRPSMVV  1980
NQGSTLDLFN QKDYENGDKF PRAHNEIYQH QQPQDDQQLL LQYISQHLGF SGSKPVAALL  2040
VYQCLLQWRS FETAKTGVFD SILQTINSTI EAEHDTRSLA YWLSNLSTLS VLLQRSYKTT  2100
RAAISTPHRR RFSYERIFEA NQTSNSGLAY FSAQSVDGPT GLQQIDAKYP AMLFKQQLVD  2160
LIEKVYGMIS DKVKKELNPL LELCIQDPRI SHSNQAKASL SSASHLGQQS QLTHWLGIVK  2220
ILNNCLHLLR ANHVPSILTH KLLTQIFSMV NVQLFNRLLL RRECCSFSNG EYIRAGLTQV  2280
KHWCNDVTQE FADSAWEALR HIRQAVDFLV ISLKPIRTWS EICNDVCPAL SLQQLERIVG  2340
MYWDDMNGTN IISAEFTSSM RTMMKEESNN ATSFSVLLDD DSSIPFSLED IAKSMPTIEE  2400
TTENDLLPFV RENHSFAFIL QRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2dfs_A0.02831309111076Myosin-5A
2dfs_M0.02831309111076Myosin-5A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMyosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation. Functions by binding with its tail domain to receptor proteins on organelles and exerting force with its N-terminal motor domain against actin filaments, thereby transporting its cargo along polarized actin cables. Involved in trafficking of Golgi stacks, mitochondria and peroxisomes. {ECO:0000269|PubMed:18503043, ECO:0000269|PubMed:19369591, ECO:0000269|PubMed:21914656}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G31630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693143.10.0PREDICTED: myosin-9-like
SwissprotF4HWY60.0MYO11_ARATH; Myosin-11
TrEMBLJ3M9890.0J3M989_ORYBR; Uncharacterized protein
STRINGOB05G31630.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP10733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.17e-36WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Hodge T,Cope MJ
    A myosin family tree.
    J. Cell. Sci., 2000. 113 Pt 19: p. 3353-4
    [PMID:10984423]
  2. Reddy AS,Day IS
    Analysis of the myosins encoded in the recently completed Arabidopsis thaliana genome sequence.
    Genome Biol., 2001. 2(7): p. RESEARCH0024
    [PMID:11516337]
  3. Sparkes IA,Teanby NA,Hawes C
    Truncated myosin XI tail fusions inhibit peroxisome, Golgi, and mitochondrial movement in tobacco leaf epidermal cells: a genetic tool for the next generation.
    J. Exp. Bot., 2008. 59(9): p. 2499-512
    [PMID:18503043]
  4. Avisar D, et al.
    A comparative study of the involvement of 17 Arabidopsis myosin family members on the motility of Golgi and other organelles.
    Plant Physiol., 2009. 150(2): p. 700-9
    [PMID:19369591]
  5. Peremyslov VV, et al.
    Expression, splicing, and evolution of the myosin gene family in plants.
    Plant Physiol., 2011. 155(3): p. 1191-204
    [PMID:21233331]
  6. Avisar D,Abu-Abied M,Belausov E,Sadot E
    Myosin XIK is a major player in cytoplasm dynamics and is regulated by two amino acids in its tail.
    J. Exp. Bot., 2012. 63(1): p. 241-9
    [PMID:21914656]
  7. Madison SL, et al.
    Class XI Myosins Move Specific Organelles in Pollen Tubes and Are Required for Normal Fertility and Pollen Tube Growth in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 1946-60
    [PMID:26358416]
  8. Kinkema M,Wang H,Schiefelbein J
    Molecular analysis of the myosin gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 1994. 26(4): p. 1139-53
    [PMID:7811972]