PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G30320.1
Common NameLOC102705628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family VOZ
Protein Properties Length: 656aa    MW: 71879 Da    PI: 5.5379
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G30320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ421.81.1e-1293095261217
           VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                   p+ps++lgpkcalwdc rp++gse+++dyc+ +ha laln+ gl+gt+pv+rp+gidlkdg+lfaalsak qgk+vgip+cegaat+kspwna+elf
  OB05G30320.1 309 PSPSQYLGPKCALWDCGRPVRGSEECKDYCNPYHAGLALNDdGLLGTRPVMRPRGIDLKDGPLFAALSAKNQGKNVGIPVCEGAATTKSPWNAPELF 405
                   89**************************************9799***************************************************** PP

           VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdek 193
                   dlsllege++rewlffd+prrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpss++ewhl+eyein++dalalyrle+k++d+k
  OB05G30320.1 406 DLSLLEGESLREWLFFDTPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSNYEWHLFEYEINDSDALALYRLEYKSSDTK 502
                   ************************************************************************************************* PP

           VOZ 194 ksakgkvskdsladlqkklgrlta 217
                   +s+k+k+++++l+++q+++++l+a
  OB05G30320.1 503 RSVKSKLTSSPLNEIQQQMVKLSA 526
                   **********************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MAGDPTAGGV GGRGSSGGKG SSRSSSRHQQ FRNLAKTRVD DLQEMFSGLQ SARKESRSAD  60
AALLEEQVHH MLREWRAELS VPSPASSLQN SQSQGNKREA SDPPSETLRL LQLAGAEEED  120
DATSKLVMPR SPLPMPASSH EGHGHGQAGH NLNPVLQGGT AEMVPHSPLQ MPSSHQSHGH  180
GQNLNPNMQG EAVLGSAAAP QQSLDQGMQD DCGDAAGAAN AMFHDQLYYI DHELDIDDFL  240
RDDDYKMNLS GSNPDGPNTL QGLDQLEHQQ YNLPLDLPPP NSYVDTNNSA QSSGDVFFHM  300
SDLLTTMYPS PSQYLGPKCA LWDCGRPVRG SEECKDYCNP YHAGLALNDD GLLGTRPVMR  360
PRGIDLKDGP LFAALSAKNQ GKNVGIPVCE GAATTKSPWN APELFDLSLL EGESLREWLF  420
FDTPRRAFES GNRKQRSLPD YNGRGWHESR KQVMKDFGGL KRSYYMDPQP SSNYEWHLFE  480
YEINDSDALA LYRLEYKSSD TKRSVKSKLT SSPLNEIQQQ MVKLSADSPV ENKRTARSRP  540
KANQKDNNSN TYPAVNTPNQ ASASNAHQPM SLNTPNQASA SNSHQPMSLN APDQVNVSNA  600
YQTVPPSQAG PSNTYHPASQ MDQMTFLDGS VVYGPHLPYG YSTERSDFYW NPTDGT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G30320.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0690760.0AK069076.1 Oryza sativa Japonica Group cDNA clone:J023004H20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654646.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-112VOZ1_ARATH; Transcription factor VOZ1
TrEMBLJ3M8V80.0J3M8V8_ORYBR; Uncharacterized protein
STRINGOB05G30320.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-109vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]