PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G30280.1
Common NameLOC102705075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 589aa    MW: 64448.4 Da    PI: 9.1122
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G30280.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.43.1e-2433134199
                   EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                   f+k+lt sd++++g +++p++ ae++      + +   s++l+ +d++g +W++++iyr++++r++lt+GW++Fv+ ++L +gD v+F   + ++++
  OB05G30280.1  33 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKTIR-PSQELIAMDLHGTQWKFRHIYRGQPRRHLLTTGWSSFVNRKKLVSGDAVLFL--RGDDGQ 126
                   99****************************873333.4569************************************************..348888 PP

                   .EEEEE-S CS
            B3  92 lvvkvfrk 99 
                   l+++v+r+
  OB05G30280.1 127 LRLGVRRA 134
                   99999986 PP

2Auxin_resp108.76e-36159239182
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                   +a+++++ks+F+v++nPr+++seF+v++++++k+l++++s+GmRfk  +e+ed++er+ +G+v+g++++dp+rWp+S+W++L
  OB05G30280.1 159 VANSLENKSIFHVCFNPRSGASEFIVPYWRFLKSLNHPFSIGMRFKACYESEDANERS-TGLVSGINEVDPIRWPGSRWKCL 239
                   68999****************************************************9.9*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.49E-4322171IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-3828136IPR015300DNA-binding pseudobarrel domain
CDDcd100176.35E-2331133No hitNo description
SMARTSM010192.5E-2333135IPR003340B3 DNA binding domain
PROSITE profilePS5086312.99933135IPR003340B3 DNA binding domain
PfamPF023623.2E-2233134IPR003340B3 DNA binding domain
PfamPF065071.1E-28160239IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MLRRNFRGGG GEDGAGEMEG CDAEKKPRMP HMFCKTLTAS DTSTHGGFSV PRRAAEDCFP  60
PLDYKTIRPS QELIAMDLHG TQWKFRHIYR GQPRRHLLTT GWSSFVNRKK LVSGDAVLFL  120
RGDDGQLRLG VRRAVQLRNE ALFEPVNSSD SKLRILSAVA NSLENKSIFH VCFNPRSGAS  180
EFIVPYWRFL KSLNHPFSIG MRFKACYESE DANERSTGLV SGINEVDPIR WPGSRWKCLL  240
VRWDDSTDNN HQNRVSPWEI ERVGGSVSVT HSLSSGSKRT KLHFPQGNLD TPFLNGNGHP  300
ESMGTENFHR VLQGQEFRGS RSHGVVCSEP PGPAVPNFQA PDNRRFSANM RGYMMPASAP  360
PQRNTEFTYQ PVGFGESLGF PEVLQGQEMS QVVPLFRGAT SGARTQNDRV VSTNSVHRSA  420
ALSGLPAATQ GHAISQFTLS ASKVSSPSSV LMFNQATAPH LEPKDGAGNK GIYGSQFASQ  480
EMLAEAVTWP AIQHQMPTAS SQFAMAKASA PPSRAESGSP KSGAGRSSCR LFGFSLTENM  540
LGEDAQVLEE GSSEAERQNP RVLELFGHRH SHSTPGALHA LCAAAPLGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A2e-7533261158388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G30280.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by auxin under light condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679270.0AK067927.1 Oryza sativa Japonica Group cDNA clone:J013127F13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654644.10.0PREDICTED: auxin response factor 14
SwissprotQ0DGS10.0ARFN_ORYSJ; Auxin response factor 14
TrEMBLJ3M8V40.0J3M8V4_ORYBR; Auxin response factor
STRINGOB05G30280.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51132756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-121ARF family protein
Publications ? help Back to Top
  1. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]