PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G28830.1
Common NameLOC102712536
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YC
Protein Properties Length: 287aa    MW: 31880.4 Da    PI: 4.8389
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G28830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC61.32e-196861898
         NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                  ++++P  rikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t+  s +++++ + +++dfl d+v +
  OB05G28830.1  6 DTRFPAPRIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCNRTYGITVQRGVKTVSSSHLKQCIHSYNVYDFLRDVVSK 86
                  5789**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-24372IPR009072Histone-fold
SuperFamilySSF471131.71E-19488IPR009072Histone-fold
PfamPF008081.5E-17871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MRKKLDTRFP APRIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCNRT YGITVQRGVK  60
TVSSSHLKQC IHSYNVYDFL RDVVSKVPDM GTSDAGVDDK LGKRRKTAED DSEEESKRTR  120
NEAANHTNNG RGRGRGRGRG RRGGRGSERE ILSAYEKFEE NHEFPPGEFS KPVELKVDVS  180
VDGTEANEAK EVTPLSNARA SLRNIDLNID LTDYDDEDSA PPEVQPSAPA VGVLTASSGP  240
PVSEVKEEAK TKDLLGWQLP EINMDPVQFA LSSNHRLEED EDYDNEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-22271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130139RGRGRGRGRG
2130140RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880480.0AB288048.1 Oryza sativa Japonica Group OsDrAp2 mRNA for repressor protein, complete cds.
GenBankAK0683200.0AK068320.1 Oryza sativa Japonica Group cDNA clone:J013150F08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654586.10.0PREDICTED: dr1-associated corepressor-like isoform X1
TrEMBLJ3M8F90.0J3M8F9_ORYBR; Uncharacterized protein
STRINGOB05G28830.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21723679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.11e-54nuclear factor Y, subunit C11