PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G28440.1
Common NameLOC102707873
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 332aa    MW: 35729.1 Da    PI: 6.8293
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G28440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11.1e-14262305548
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                   +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+
  OB05G28440.1 262 RRQKRMIKNRESAARSRARKQAYTNELENKVLRLEEENERLKKQ 305
                   69***************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.5E-14256305No hitNo description
SMARTSM003383.9E-10258314IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.553260305IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-10262307No hitNo description
CDDcd147075.38E-26262309No hitNo description
PfamPF001701.4E-12262305IPR004827Basic-leucine zipper domain
PROSITE patternPS000360265280IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MIQAMASHAG GSSGGGRDAG AARGGAMQSL VRQGSLYGLT LNEVQSQLGE PLLSMNLDEL  60
LRSVFPEGVD PDGGGSVAGQ SQPAMGLQRQ GSITMPPELS KKTVDEVWKG IQDVPKRGAE  120
EGGRRRRERQ PTLGEMTLED FLVKAGVVTD GYLKDPNDLP VNMDVVGGTA AAASTSDLNA  180
GAQWVQQYQQ QAFEPQHSSI AAPYMASHLA PQPLAVATGS VLDPIYSDGQ ITSPMLGALS  240
DPQTPGRKRG ASGEIADKIV ERRQKRMIKN RESAARSRAR KQAYTNELEN KVLRLEEENE  300
RLKKQKELDE ILNSAPPPEP KYQLRRTSSA GF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122129GRRRRERQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0633980.0AK063398.1 Oryza sativa Japonica Group cDNA clone:001-114-H11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654569.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES32e-87AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLJ3M8C00.0J3M8C0_ORYBR; Uncharacterized protein
STRINGOB05G28440.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-67ABA-responsive element binding protein 3