PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G27610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 732aa    MW: 81448.7 Da    PI: 5.6254
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G27610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1061.9e-33324382159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYGqK+vkg+++prsYY+Ct+agCpv+k+ver+++d ++v++tYeg+Hnh+
  OB05G27610.1 324 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERASNDLRAVITTYEGKHNHD 382
                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-37309384IPR003657WRKY domain
SuperFamilySSF1182902.35E-29316384IPR003657WRKY domain
PROSITE profilePS5081138.526319384IPR003657WRKY domain
SMARTSM007741.4E-38324383IPR003657WRKY domain
PfamPF031067.5E-26325382IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MTAAPGSLQL VNSRPVALSL ASRPSFSSLL GSGSFKAAMT TPSSLAPAAT SPSSYFGVSS  60
GFLESPILFT PSLFPSPTTT GPFPSEPFSW MTTPTTTAPE NQVQGGVKDE QRQHSGFTFQ  120
PPASTAPATT STSFMQTSML MAPLQGESYN GEQQQPWSYQ ESSMDAATKP EDFTTPPFEG  180
ASLGKKVEQS PDGQVTEIVY KGAHSHPKPQ QNGRGRGSGG APSYALHGGG ASDAHSADAL  240
SGTPVATPEN SSASFGDDEV NGVSSSLQVG ANAAAAGEDL DDDEPDSKRW RKDSDGEGVS  300
LVAGNRTVRE PRVVVQTMSD IDILDDGYRW RKYGQKVVKG NPNPRSYYKC TTAGCPVRKH  360
VERASNDLRA VITTYEGKHN HDVPAGRGGX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  420
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  480
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  540
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  600
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  660
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  720
XXXASPCPGS TT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-36315385878Probable WRKY transcription factor 4
2lex_A4e-36315385878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G27610.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2981840.0DQ298184.1 Oryza sativa (japonica cultivar-group) WRKY transcription factor 70 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637836.11e-148WRKY transcription factor WRKY24
SwissprotQ6B6R41e-106WRK24_ORYSI; WRKY transcription factor WRKY24
TrEMBLJ3M8370.0J3M837_ORYBR; Uncharacterized protein
STRINGOB05G27610.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.12e-59WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]