PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G25740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 134aa    MW: 14698.3 Da    PI: 6.0191
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G25740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22e-1461113355
                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                   + +r++r++kNRe+A rsR+RK+a+i+eLe  v eLe+e  +L  e ee +++
  OB05G25740.1  61 AMQRQKRMIKNRESAARSRERKQAYIAELEAQVTELEEEHAQLLREQEEKNQK 113
                   689***************************************99877765554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-859123IPR004827Basic-leucine zipper domain
PfamPF001701.4E-1261111IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.81861109IPR004827Basic-leucine zipper domain
CDDcd147071.86E-1663109No hitNo description
SuperFamilySSF579593.63E-1163111No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-1364110No hitNo description
PROSITE patternPS0003606681IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MTLEDFLARE DDPRATAVEG NIVVGFPDGA EGAGTVGGGG RGSGAGRGRK RALMDPADRA  60
AMQRQKRMIK NRESAARSRE RKQAYIAELE AQVTELEEEH AQLLREQEEK NQKRLKEDAN  120
CVDIKNGPSY NSVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8341091e-126CT834109.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA060C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655359.21e-77PREDICTED: G-box-binding factor 4-like
SwissprotP427772e-25GBF4_ARATH; G-box-binding factor 4
TrEMBLJ3M7K04e-93J3M7K0_ORYBR; Uncharacterized protein
STRINGOB05G25740.11e-92(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.14e-14G-box binding factor 4