PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G14280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 125aa    MW: 13791.4 Da    PI: 7.85
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G14280.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.74.1e-3815103189
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                   +CaaCk+lrr+Ca++C+++pyf   +p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq+  
  OB05G14280.1  15 PCAACKLLRRRCAQECPFSPYFSPLEPHKFASVHKVFGASNVSKMLLEVQESQRGDAANSLVYEANLRLRDPVYGCMGAILTLQQQVXX 103
                   7*************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.13114125IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3815103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
GAEELQPAGG XTITPCAACK LLRRRCAQEC PFSPYFSPLE PHKFASVHKV FGASNVSKML  60
LEVQESQRGD AANSLVYEAN LRLRDPVYGC MGAILTLQQQ VXXXXXXXXX XXXXXXXXXX  120
XXPPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-35151011197LOB family transfactor Ramosa2.1
5ly0_B1e-35151011197LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G14280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-107FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025881485.12e-61LOB domain-containing protein 15 isoform X1
RefseqXP_025881486.12e-61LOB domain-containing protein 15 isoform X2
SwissprotQ9AT612e-54LBD13_ARATH; LOB domain-containing protein 13
TrEMBLJ3M4A41e-66J3M4A4_ORYBR; Uncharacterized protein
STRINGOB05G14280.12e-67(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.17e-57LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]