PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G12090.1
Common NameLOC102704800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 150aa    MW: 16120.1 Da    PI: 10.7471
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G12090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.51.4e-132479459
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
                   ++ +r+ +NRe+ArrsR+RK++++eeL  +++ L+aeN +   ++  +  e  k+
  OB05G12090.1 24 ERKRKRMLSNRESARRSRARKQQRLEELIAEAARLQAENARVEAQIGAYARELGKV 79
                  5678999*********************************9999998888776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-182185IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.0E-122278No hitNo description
PROSITE profilePS5021711.4152386IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.75E-102577No hitNo description
PfamPF001702.4E-92575IPR004827Basic-leucine zipper domain
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSSPSRRSSS PESNTSGGGS GADERKRKRM LSNRESARRS RARKQQRLEE LIAEAARLQA  60
ENARVEAQIG AYARELGKVD GDNAVLRARH GELAGRLQAL GGVLEIFQVA GASVDIPEIP  120
DPLLRPWQPP FAAQPIATAA TGAMADAFQF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13744RRSRARKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8418561e-159CT841856.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C105C20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654003.11e-103PREDICTED: ocs element-binding factor 1-like
TrEMBLJ3M3N51e-103J3M3N5_ORYBR; Uncharacterized protein
STRINGOB05G12090.11e-102(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.12e-21basic region/leucine zipper motif 53