PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G11740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 195aa    MW: 21223.1 Da    PI: 7.7365
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G11740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.42.4e-43341331100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+C++ Cvlapyfp ++p+kf  +h++FGasn++kll++lpee+r da+ss+vyeA+ar+rdPvyG++g i +lq+q++ lka+la++
  OB05G11740.1  34 PCAACKILRRRCVDRCVLAPYFPPTEPHKFTTAHRVFGASNIIKLLQELPEEQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVNDLKAQLARA 130
                   7***********************************************************************************************9 PP

        DUF260  98 kee 100
                   ++e
  OB05G11740.1 131 HAE 133
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.43633134IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4334131IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MGSSSDTACT VATAPPSPAS PPATATTTTV VLSPCAACKI LRRRCVDRCV LAPYFPPTEP  60
HKFTTAHRVF GASNIIKLLQ ELPEEQRADA VSSMVYEANA RIRDPVYGCA GAICQLQKQV  120
NDLKAQLARA HAELAGXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXAGG  180
MQASPIGWVD EPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-45251342111LOB family transfactor Ramosa2.1
5ly0_B7e-45251342111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G11740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9539378e-95EU953937.1 Zea mays clone 1449845 LOB domain protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654943.11e-94PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK088e-59LBD11_ARATH; LOB domain-containing protein 11
TrEMBLJ3M3K01e-102J3M3K0_ORYBR; Uncharacterized protein
STRINGOB05G11740.11e-103(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-57LOB domain-containing protein 11